PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04850.1
Common NameT9J14.20, TCX4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 639aa    MW: 70973.6 Da    PI: 4.9815
Description Tesmin/TSO1-like CXC domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR482.5e-15451489240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+C+C+ks+Clk+YCeCf+ag +C+e C+C++C+Nk 
  AT3G04850.1 451 SCKRCKCRKSQCLKLYCECFSAGLFCGEPCSCQNCFNKP 489
                  589**********************************96 PP

2TCR50.25.1e-16536575140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+gCnC+ks C kkYCeCf  g+ Cs++C+C +CkN+ 
  AT3G04850.1 536 RHKRGCNCRKSGCSKKYCECFMMGVGCSSNCRCMGCKNTF 575
                  589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.3E-18450491IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.966451576IPR005172CRC domain
PfamPF036387.7E-11453488IPR005172CRC domain
SMARTSM011143.7E-18536577IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-11538574IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MDTPDKNRIS AVSFCNFEDS PVFQYINDLS PIEPVKPGRP ENILHSLVFT SPSSSSSLFC  60
SPQLNSYRDS RFFIKRHRSL DLSSPVVLIG ETLKNSPDAL WEEKLKCRPE KLENVSEPKP  120
FKEQISLAIE LANSLKHGRD GCDIQMVSCD EVPMDADDEI GSGGGSRELS DELCRQSFDP  180
LDFDADSDGV LHTDEMEAES GFGKEVIMFD VADIQNYEQQ IPRTTDPRFY SLASEPQQFS  240
IYCNNSNYVE EREGSCSVQV AAGAPDINLS CSSKVAAIDS TAEAEDKEDK DLQPSGKQRS  300
VRRRCLTFDM GGSHKRIPLR DSTNDLPLDS TSINKAPSPQ NCLDTSKQDT DEILPIPRTI  360
GLHLNGFVNP SVSSGRKKKK IKDGQAFPST TFHYNIEDEF STPVSTKRDL VVFSDVKIME  420
PPERSVEGEC FDQLMAMENR QLSQGLDELG SCKRCKCRKS QCLKLYCECF SAGLFCGEPC  480
SCQNCFNKPI HEDLVMKSRE VIKARNPLAF APKVVSTSDT VIDLWVENSK TPASARHKRG  540
CNCRKSGCSK KYCECFMMGV GCSSNCRCMG CKNTFGHTNE QCAGDSDVVT INDEAKHYGD  600
HGDASRQNEE ILTSERNRLL LPGSVAFRSL TSLSNLSEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1645357312120Protein lin-54 homolog
5fd3_B2e-1645357312120Protein lin-54 homolog
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G04850
AtGenExpressAT3G04850
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G04850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G04850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0039260.0BT003926.1 Arabidopsis thaliana clone RAFL15-25-I04 (R20696) unknown protein (At3g04850) mRNA, complete cds.
GenBankBT0050100.0BT005010.1 Arabidopsis thaliana clone U20696 unknown protein (At3g04850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187136.30.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLA0A178VLW70.0A0A178VLW7_ARATH; Uncharacterized protein
STRINGAT3G04850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Representative plantOGRP9931755
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]