PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04450.1
Common NamePHL13, T27C4.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 442aa    MW: 49400.2 Da    PI: 5.8803
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.5e-32238292155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWtpeLHe+Fvea++qLGGse+AtPk++l+l++ +gLt++hvkSHLQkYR+
  AT3G04450.1 238 KQRMRWTPELHEAFVEAINQLGGSERATPKAVLKLINSPGLTVYHVKSHLQKYRT 292
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.607235295IPR017930Myb domain
SuperFamilySSF466897.17E-17236292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-29237294IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-23238292IPR006447Myb domain, plants
PfamPF002493.7E-10240291IPR001005SANT/Myb domain
PfamPF143791.2E-21326373IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MTLASDFGFP SAISSSFTIL EERYHNNFPN TLCVSSGQES MNNNPVPCQV FPLVSGGSSG  60
GNLFSSSSGF CNGVYVSSSS QARPSVSTVP RDRITVAHVS GEGQRQECPV ETHSLQLINQ  120
PQEQKIMTWS SDQIRGFFDF PVPDPQAASS RTMVSSKEVL SKCEWPDWAD QLISDDSLEP  180
NWSELLGDPN VLNLYSKIET QSSDIARQEI VFRNQHQVDP SMEPFNAKSP PASSMTSKQR  240
MRWTPELHEA FVEAINQLGG SERATPKAVL KLINSPGLTV YHVKSHLQKY RTARYKPELS  300
KDTEEPLVKN LKTIEDIKSL DLKTSIEITE ALRLQMKVQK QLHEQLEIQR SLQLQIEEQG  360
RYLQMMIEKQ QKMQENKKDS TSSSSMPEAD PSAPSPNLSQ PFLHKATNSE PSITQKLQNG  420
SSTMDQSEST SGTSNRKRVR ED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-28238296260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258626_at0.0
Expression AtlasAT3G04450-
AtGenExpressAT3G04450-
ATTED-IIAT3G04450-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G04450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G04450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186300.0AK118630.1 Arabidopsis thaliana At3g04450 mRNA for putative transfactor, complete cds, clone: RAFL19-89-P11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001319469.10.0Homeodomain-like superfamily protein
SwissprotF4J3P70.0PHLD_ARATH; Myb family transcription factor PHL13
TrEMBLA0A178VHS90.0A0A178VHS9_ARATH; Uncharacterized protein
STRINGAT3G04450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  8. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]