PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04420.1
Common Nameanac048, NAC048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 342aa    MW: 39037.7 Da    PI: 5.0866
Description NAC domain containing protein 48
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04420.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.47.6e-4241322128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  p+G+rF+Ptd+e+vv+yL++k ++++  ++++vi++v i +++Pw+Lp + ++k ++++w fFs++++ky +g+++ r+tksgyWk tgk k++l+ +
  AT3G04420.1   4 PVGLRFRPTDKEIVVDYLRPKNSDRDtSHVDRVISTVTIRSFDPWELPcQsRIKLKDESWCFFSPKENKYGRGDQQIRKTKSGYWKITGKPKPILR-N 100
                  89*******************999984566678**************96348888999*************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g kk+L+fy  ++  g+k+dWvmhey++
  AT3G04420.1 101 RQEIGEKKVLMFYMSKELGGSKSDWVMHEYHA 132
                  999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-482150IPR003441NAC domain
PROSITE profilePS5100544.1733150IPR003441NAC domain
PfamPF023654.8E-224131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MENPVGLRFR PTDKEIVVDY LRPKNSDRDT SHVDRVISTV TIRSFDPWEL PCQSRIKLKD  60
ESWCFFSPKE NKYGRGDQQI RKTKSGYWKI TGKPKPILRN RQEIGEKKVL MFYMSKELGG  120
SKSDWVMHEY HAFSPTQMMM TYTICKVMFK GDVREISSSS ASYGSEIEQS RDSLIPLLVN  180
DSEEEAQIED AIPIEEWETW LTDDGVDEQV NHIMNMKDDR NNHRPQKPLT GVLIDDSSDD  240
DDDSDLLSPT TNSIENSSTC DSFGSSDQIN LVSLTQEVSQ ALITSIDTPE KIKSPYDDAQ  300
GTGAGGQKLG QETREKKRAG FFHRMIQIFV KKIHQCSSIS RT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-28413718147NAC domain-containing protein 19
4dul_A6e-28413718147NAC domain-containing protein 19
1ut7_B6e-28413718147NO APICAL MERISTEM PROTEIN
1ut7_A6e-28413718147NO APICAL MERISTEM PROTEIN
1ut4_B6e-28413718147NO APICAL MERISTEM PROTEIN
1ut4_A6e-28413718147NO APICAL MERISTEM PROTEIN
3swp_D7e-28413721150NAC domain-containing protein 19
3swp_C7e-28413721150NAC domain-containing protein 19
3swp_B7e-28413721150NAC domain-containing protein 19
3swp_A7e-28413721150NAC domain-containing protein 19
3swm_D7e-28413721150NAC domain-containing protein 19
3swm_C7e-28413721150NAC domain-containing protein 19
3swm_B7e-28413721150NAC domain-containing protein 19
3swm_A7e-28413721150NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.273620.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258571_at0.0
Expression AtlasAT3G04420-
AtGenExpressAT3G04420-
ATTED-IIAT3G04420-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G04420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G04420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008460.0BT000846.1 Arabidopsis thaliana At3g04420/T27C4_6 mRNA, complete cds.
GenBankAY0605870.0AY060587.1 Arabidopsis thaliana AT3g04420/T27C4_6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566226.10.0NAC domain containing protein 48
SwissprotQ5PP281e-161NAC3_ARATH; NAC domain-containing protein 3
TrEMBLQ8W4R40.0Q8W4R4_ARATH; AT3g04420/T27C4_6
STRINGAT3G04420.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM23151676
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]