PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04100.1
Common NameAGL57, T6K12.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 207aa    MW: 24098.1 Da    PI: 10.5185
Description AGAMOUS-like 57
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04100.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF542.1e-172170150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 k++en+  r +tfskR++gi+KK +EL  +Cd+eva +ifs+  k y+++
  AT3G04100.1 21 KKVENYGDRMITFSKRKTGIFKKMNELVAMCDVEVAFLIFSQPKKPYTFA 70
                 6789********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-231388IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-211372IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.0861373IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-161535IPR002100Transcription factor, MADS-box
PfamPF003194.4E-192269IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-163550IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-165071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0020093anatomyantipodal cell
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MSSTKQAKGR KTKGKQKIEM KKVENYGDRM ITFSKRKTGI FKKMNELVAM CDVEVAFLIF  60
SQPKKPYTFA HPSMKKVADR LKNPSRQEPL ERDDTRPLVE AYKKRRLHDL VKKMEALEEE  120
LAMDLEKLKL LKESRNEKKL DKMWWNFPSE GLSAKELQQR YQAMLELRDN LCDNMAHLRL  180
GKDCGGSSSV RVGRRVSGGV RLFDREA
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258583_at0.0
Expression AtlasAT3G04100-
AtGenExpressAT3G04100-
ATTED-IIAT3G04100-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G04100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G04100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATAC0168290.0AC016829.7 Arabidopsis thaliana chromosome III BAC T6K12 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankDQ0565860.0DQ056586.1 Arabidopsis thaliana MADS-box family protein (At3g04100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187060.11e-152AGAMOUS-like 57
TrEMBLQ9M8W61e-150Q9M8W6_ARATH; AGAMOUS-like 57
STRINGAT3G04100.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Hoen DR, et al.
    Transposon-mediated expansion and diversification of a family of ULP-like genes.
    Mol. Biol. Evol., 2006. 23(6): p. 1254-68
    [PMID:16581939]
  7. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]