PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04060.1
Common Nameanac046, NAC046, T11I18.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 338aa    MW: 37780.6 Da    PI: 6.7949
Description NAC domain containing protein 46
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.3e-54201461128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdee++++yLk+kv + ++++  +i ++d++k ePwdLpk +k +eke yfF++rd+ky+tg r+nrat sgyWkatgkdke+++ kg 
  AT3G04060.1  20 LPPGFRFHPTDEEIITHYLKEKVFNIRFTA-AAIGQADLNKNEPWDLPKIAKMGEKEFYFFCQRDRKYPTGMRTNRATVSGYWKATGKDKEIFRGKGC 116
                  79*************************999.78***************8888899***************************************9*** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfy+grapkgekt+Wvmheyrl
  AT3G04060.1 117 LVGMKKTLVFYTGRAPKGEKTNWVMHEYRL 146
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6217172IPR003441NAC domain
PROSITE profilePS5100558.01820171IPR003441NAC domain
PfamPF023658.2E-2921146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVEEGGVVVN QGGDQEVVDL PPGFRFHPTD EEIITHYLKE KVFNIRFTAA AIGQADLNKN  60
EPWDLPKIAK MGEKEFYFFC QRDRKYPTGM RTNRATVSGY WKATGKDKEI FRGKGCLVGM  120
KKTLVFYTGR APKGEKTNWV MHEYRLDGKY SYHNLPKTAR DEWVVCRVFH KNAPSTTITT  180
TKQLSRIDSL DNIDHLLDFS SLPPLIDPGF LGQPGPSFSG ARQQHDLKPV LHHPTTAPVD  240
NTYLPTQALN FPYHSVHNSG SDFGYGAGSG NNNKGMIKLE HSLVSVSQET GLSSDVNTTA  300
TPEISSYPMM MNPAMMDGSK SACDGLDDLI FWEDLYTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-511817315167NAC domain-containing protein 19
4dul_A3e-511817315167NAC domain-containing protein 19
1ut7_B3e-511817315167NO APICAL MERISTEM PROTEIN
1ut7_A3e-511817315167NO APICAL MERISTEM PROTEIN
1ut4_B3e-511817315167NO APICAL MERISTEM PROTEIN
1ut4_A3e-511817315167NO APICAL MERISTEM PROTEIN
3swp_D4e-511817318170NAC domain-containing protein 19
3swp_C4e-511817318170NAC domain-containing protein 19
3swp_B4e-511817318170NAC domain-containing protein 19
3swp_A4e-511817318170NAC domain-containing protein 19
3swm_D4e-511817318170NAC domain-containing protein 19
3swm_C4e-511817318170NAC domain-containing protein 19
3swm_B4e-511817318170NAC domain-containing protein 19
3swm_A4e-511817318170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.279060.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183967570.0
Genevisible258813_at0.0
Expression AtlasAT3G04060-
AtGenExpressAT3G04060-
ATTED-IIAT3G04060-
Function -- GeneRIF ? help Back to Top
  1. Protein intrinsic disorder in Arabidopsis NAC transcription factors: transcriptional activation by ANAC013 and ANAC046 and their interactions with RCD1.
    [PMID: 25348421]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G04060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G04060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0848520.0AY084852.1 Arabidopsis thaliana clone 119460 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187056.10.0NAC domain containing protein 46
SwissprotQ9FLJ25e-94NC100_ARATH; NAC domain-containing protein 100
TrEMBLQ9SQQ60.0Q9SQQ6_ARATH; AT3g04060/T11I18_17
STRINGAT3G04060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM22692775
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  4. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  5. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Jaspers P, et al.
    Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.
    Plant J., 2009. 60(2): p. 268-79
    [PMID:19548978]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  9. Pei H, et al.
    An NAC transcription factor controls ethylene-regulated cell expansion in flower petals.
    Plant Physiol., 2013. 163(2): p. 775-91
    [PMID:23933991]
  10. O'Shea C, et al.
    Protein intrinsic disorder in Arabidopsis NAC transcription factors: transcriptional activation by ANAC013 and ANAC046 and their interactions with RCD1.
    Biochem. J., 2015. 465(2): p. 281-94
    [PMID:25348421]
  11. Oda-Yamamizo C, et al.
    The NAC transcription factor ANAC046 is a positive regulator of chlorophyll degradation and senescence in Arabidopsis leaves.
    Sci Rep, 2016. 6: p. 23609
    [PMID:27021284]