PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04030.3
Common NameMYR2, NSR1, PHL9, T11I18.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 394aa    MW: 44612.1 Da    PI: 7.189
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04030.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.8e-344599155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprl+Wtp+LHerF+eav+qLGG++kAtPkti+++m+++gLtl+h+kSHLQkYRl
  AT3G04030.3 45 KPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 99
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.22742102IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3143100IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2345100IPR006447Myb domain, plants
PfamPF002494.6E-104798IPR001005SANT/Myb domain
PfamPF143791.3E-25147192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000293anatomyguard cell
PO:0005417anatomyphloem
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MYYQNQHQGK NILSSSRMHI TSERHPFLRG NSPGDSGLIL STDAKPRLKW TPDLHERFIE  60
AVNQLGGADK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANNS FNKIGIMTMM  120
EEKTPDADEI QSENLSIGPQ PNKNSPIGEA LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK  180
YLQSVLEKAQ ETLGRQNLGA AGIEAAKVQL SELVSKVSAE YPNSSFLEPK ELQNLCSQQM  240
QTNYPPDCSL ESCLTSSEGT QKNSKMLENN RLGLRTYIGD STSEQKEIME EPLFQRMELT  300
WTEGLRGNPY LSTMVSEAEQ RISYSERSPG RLSIGVGLHG HKSQHQQGNN EDHKLETRNR  360
KGMDSTTELD LNTHVENYCT TRTKQFDLNG FSWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258807_at0.0
Expression AtlasAT3G04030-
AtGenExpressAT3G04030-
ATTED-IIAT3G04030-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Function -- GeneRIF ? help Back to Top
  1. alternative splicing of MYR1 and MYR2 may result in changes in dimerization or protein folding resulting in changes in activity and abundance of MYR1 or MYR2 protein.[MYR2]
    [PMID: 24309816]
  2. The results suggest that NSR1/MYR2 plays a role in Nitrogen (N) reutilization as a negative regulator through controlling ASN1 expression.
    [PMID: 28818378]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G04030.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G04030
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype when grown under long days conditions, but early flowering when grown under short days conditions. {ECO:0000269|PubMed:21255164}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G04030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2220890.0HQ222089.1 Arabidopsis thaliana myb family transcription factor (MYR2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118567.10.0Homeodomain-like superfamily protein
SwissprotQ9SQQ90.0PHL9_ARATH; Myb-related protein 2
TrEMBLA0A178VA500.0A0A178VA50_ARATH; MYR2
STRINGAT3G04030.30.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Todd CD,Zeng P,Huete AM,Hoyos ME,Polacco JC
    Transcripts of MYB-like genes respond to phosphorous and nitrogen deprivation in Arabidopsis.
    Planta, 2004. 219(6): p. 1003-9
    [PMID:15592750]
  5. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Zhao C,Hanada A,Yamaguchi S,Kamiya Y,Beers EP
    The Arabidopsis Myb genes MYR1 and MYR2 are redundant negative regulators of flowering time under decreased light intensity.
    Plant J., 2011. 66(3): p. 502-15
    [PMID:21255164]
  8. Zhao C,Beers E
    Alternative splicing of Myb-related genes MYR1 and MYR2 may modulate activities through changes in dimerization, localization, or protein folding.
    Plant Signal Behav, 2013. 8(11): p. e27325
    [PMID:24309816]
  9. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  10. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]