PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G03450.1
Common NameRGL2, SCL19, T21P5.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 547aa    MW: 60493.9 Da    PI: 4.5543
Description RGA-like 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G03450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.41.4e-1381805451374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv++L++cAea+++++l+la+al++r+ +la +++ +m ++a+yf++ALa+r++r  + ++++  + + +    s e      f+e +P+lkf+h+ta
  AT3G03450.1 180 LVHALVACAEAIHQENLNLADALVKRVGTLAGSQAGAMGKVATYFAQALARRIYR--DYTAETDVCAAVN---PSFEEVLEMHFYESCPYLKFAHFTA 272
                  689****************************************************..4455444555554...2333333346*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIleav +++rvH+iD++++qG+QWpaL+qaLa Rp+gpps+R+Tg+g+p+++++++l+++g++La+fA+++gv+fef+ l+a++l+dle+e++++
  AT3G03450.1 273 NQAILEAVTTARRVHVIDLGLNQGMQWPALMQALALRPGGPPSFRLTGIGPPQTENSDSLQQLGWKLAQFAQNMGVEFEFKGLAAESLSDLEPEMFET 370
                  ************************************************************************************************** PP

         GRAS 197 kp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  +p  E+l+Vn+v++lhrll++s+s+e+    +L++vk ++P +v+vveqea+hn+  Fl+rf eal+yys+lfdsle +++  s++r ++++++lgr+
  AT3G03450.1 371 RPeSETLVVNSVFELHRLLARSGSIEK----LLNTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLEDSYSLPSQDR-VMSEVYLGRQ 463
                  **9************************....************************************************87777666.567778**** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  i nvva+eg++r+erhet+++Wr r+++aGF p++l+++a kqa++ll+ ++ +dgyrvee++g+l++gW++rpL+++SaW+
  AT3G03450.1 464 ILNVVAAEGSDRVERHETAAQWRIRMKSAGFDPIHLGSSAFKQASMLLSLYAtGDGYRVEENDGCLMIGWQTRPLITTSAWK 545
                  *********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.3E-3944115No hitNo description
PfamPF120412.8E-3344109IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.381154524IPR005202Transcription factor GRAS
PfamPF035144.8E-136180545IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006952Biological Processdefense response
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009908Biological Processflower development
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0030154Biological Processcell differentiation
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009089anatomyendosperm
PO:0019018anatomyplant embryo axis
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
PO:0025374developmental stageseed dormant stage
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MKRGYGETWD PPPKPLPASR SGEGPSMADK KKADDDNNNS NMDDELLAVL GYKVRSSEMA  60
EVAQKLEQLE MVLSNDDVGS TVLNDSVHYN PSDLSNWVES MLSELNNPAS SDLDTTRSCV  120
DRSEYDLRAI PGLSAFPKEE EVFDEEASSK RIRLGSWCES SDESTRSVVL VDSQETGVRL  180
VHALVACAEA IHQENLNLAD ALVKRVGTLA GSQAGAMGKV ATYFAQALAR RIYRDYTAET  240
DVCAAVNPSF EEVLEMHFYE SCPYLKFAHF TANQAILEAV TTARRVHVID LGLNQGMQWP  300
ALMQALALRP GGPPSFRLTG IGPPQTENSD SLQQLGWKLA QFAQNMGVEF EFKGLAAESL  360
SDLEPEMFET RPESETLVVN SVFELHRLLA RSGSIEKLLN TVKAIKPSIV TVVEQEANHN  420
GIVFLDRFNE ALHYYSSLFD SLEDSYSLPS QDRVMSEVYL GRQILNVVAA EGSDRVERHE  480
TAAQWRIRMK SAGFDPIHLG SSAFKQASML LSLYATGDGY RVEENDGCLM IGWQTRPLIT  540
TSAWKLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-601805454375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.184890.0bud| floral meristem| flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306788510.0
Genevisible259042_at0.0
Expression AtlasAT3G03450-
AtGenExpressAT3G03450-
ATTED-IIAT3G03450-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in germinating seeds, flowers and siliques. Only detectable in the inflorescence, with high levels in young flower buds and significant levels in siliques. In imbibed seeds, it is restricted to seed coats, elongating regions of pre-emergent and recently emerged radicles, endosperm (especially micropylar endosperm), and embryonic axis. Not expressed in leaves, bolting stems or roots. {ECO:0000269|PubMed:11877383, ECO:0000269|PubMed:18941053, ECO:0000269|PubMed:19500306, ECO:0000269|PubMed:20093430, ECO:0000269|PubMed:20956298}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a DELLA protein, a member of the GRAS superfamily of putative transcription factors. DELLA proteins restrain the cell proliferation and expansion that drives plant growth. Negative regulator of the response to GA in controlling seed germination. GA triggers the degradation of RGL2 protein in a process blocked by both proteasome inhibitors and serine/threonine phosphatase inhibitors. The protein undergoes degradation in response to GA via the 26S proteasome. RGL2 may be involved in reducing ROS accumulation in response to stress by up-regulating the transcription of superoxide dismutases. Rapidly degraded in response to GA. Regulates GA-promoted seed germination. Involved in flower and fruit development.
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Acts as a major GA-response repressor of seed germination, including seed thermoinhibition. Promotes the biosynthesis of abscisic acid (ABA), especially in seed coats to maintain seed dormancy. Delays flowering and adult leaf production. Also regulates the floral development, petal, stamen and anther development, by repressing the continued growth of floral organs. Its activity is probably regulated by other phytohormones such as auxin and ethylene. Involved in the regulation of seed dormancy and germination, including glucose-induced delay of seed germination. Promotes salt tolerance. Acts as a repressor of positive regulators of trichome initiation. Required during the flagellin-derived peptide flg22-mediated growth inhibition. Contributes to the susceptibility to the biotrophic pathogen P.syringae pv. tomato and to the resistance to the necrotrophic pathogens B.cinerea A.brassicicola, probably by repressing the SA-defense pathway and preventing cell death. Prevents stress-induced reactive oxygen species (ROS) accumulation (e.g. salt stress) by acting on the ROS scavenging system, and delays ROS-induced cell death, thus promoting stress tolerance. {ECO:0000269|PubMed:11877383, ECO:0000269|PubMed:12610625, ECO:0000269|PubMed:14615596, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591, ECO:0000269|PubMed:16400150, ECO:0000269|PubMed:16916886, ECO:0000269|PubMed:17141619, ECO:0000269|PubMed:17384169, ECO:0000269|PubMed:17704233, ECO:0000269|PubMed:18162586, ECO:0000269|PubMed:18450450, ECO:0000269|PubMed:18450451, ECO:0000269|PubMed:18941053, ECO:0000269|PubMed:20093430, ECO:0000269|PubMed:20956298}.
Function -- GeneRIF ? help Back to Top
  1. We confirm that RGL2, one member of the DELLA family, encodes the predominant repressor of seed germination in Arabidopsis and show that the other DELLA genes GAI,RGA and RGL1 enhance the function of RGL2.
    [PMID: 16034591]
  2. role of conserved serine and threonine in GA signaling
    [PMID: 16167898]
  3. Four conserved tyrosine residues within the RGL2 protein are critical for gibberellin sensitivity in Arabidopsis.
    [PMID: 17333251]
  4. RGL2 disappearance is not a prerequisite for seed germination in the sly1 background.
    [PMID: 17384169]
  5. RGL2 inhibits Arabidopsis seed germination by stimulating abscisic acid synthesis
    [PMID: 18941053]
  6. Data documented that Lys-29 of ubiquitin is the major site for ubiquitin chain formation to mediate DELLA protein degradation that also required protein Ser/Thr dephosphorylation activity. The LZ domain is essential for both their stability and activity.
    [PMID: 19717618]
  7. The persistent high ABA levels in imbibed dormant seeds requires the permanent expression of the DELLA gene RGL2, where it remains insensitive to gibberellins (GA) unlike in nondormant seeds.
    [PMID: 20956298]
  8. RGL2 directly regulates several genes affecting various physiological aspects to inhibit germination.
    [PMID: 23035751]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G03450.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated transiently following seed imbibition to decline rapidly as germination proceeds; this induction is delayed at supraoptimal temperature conditions (e.g. 34 degrees Celsius). Accumulates in seed coats of dormant seeds where germination does not occur after imbibition. Increased levels upon abscisic acid (ABA) treatment. Down-regulated by norflurazon (NF), an ABA biosynthesis inhibitor. Induced by stress such as glucose, salt or mannitol treatment. {ECO:0000269|PubMed:11877383, ECO:0000269|PubMed:16916886, ECO:0000269|PubMed:17384169, ECO:0000269|PubMed:18162586, ECO:0000269|PubMed:18450450, ECO:0000269|PubMed:18941053, ECO:0000269|PubMed:20956298}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G24650 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G04240(A), AT2G27300(A), AT2G36270(A), AT2G41940(R), AT3G24650(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, gibberellin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G47620, AT3G62090, AT4G04890, AT4G21750, AT4G36930, AT5G66730, AT5G67110, AT1G08970, AT1G09530, AT1G32640, AT1G75080
IntActSearch Q8GXW1
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Higher germination rate in the presence of glucose and at supraoptimal temperature conditions. Rga, gai, rgl1, rgl2 and rgl3 pentuple mutant displays constitutive GA responses even in the absence of GA treatment. {ECO:0000269|PubMed:16916886, ECO:0000269|PubMed:18162586, ECO:0000269|PubMed:23482857}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G03450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ1777810.0GQ177781.1 Arabidopsis thaliana ecotype Nd-1 RGL2 gene, complete sequence.
GenBankGQ1777750.0GQ177775.1 Arabidopsis thaliana ecotype Ms-0 RGL2 gene, complete sequence.
GenBankGQ1777730.0GQ177773.1 Arabidopsis thaliana ecotype Ll-0 RGL2 gene, complete sequence.
GenBankGQ1777670.0GQ177767.1 Arabidopsis thaliana ecotype Ct-1 RGL2 gene, complete sequence.
GenBankGQ1777660.0GQ177766.1 Arabidopsis thaliana ecotype Br-0 RGL2 gene, complete sequence.
GenBankGQ1777580.0GQ177758.1 Arabidopsis thaliana ecotype Ag-0 RGL2 gene, complete sequence.
GenBankATAC0098950.0AC009895.4 Arabidopsis thaliana chromosome III BAC T21P5 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186995.10.0DELLA protein RGL2
SwissprotQ8GXW10.0RGL2_ARATH; DELLA protein RGL2
TrEMBLD7L0H60.0D7L0H6_ARALL; Putative uncharacterized protein
STRINGAT3G03450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MalvidsOGEM83728121
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Dill A,Sun T
    Synergistic derepression of gibberellin signaling by removing RGA and GAI function in Arabidopsis thaliana.
    Genetics, 2001. 159(2): p. 777-85
    [PMID:11606552]
  4. Wen CK,Chang C
    Arabidopsis RGL1 encodes a negative regulator of gibberellin responses.
    Plant Cell, 2002. 14(1): p. 87-100
    [PMID:11826301]
  5. Lee S, et al.
    Gibberellin regulates Arabidopsis seed germination via RGL2, a GAI/RGA-like gene whose expression is up-regulated following imbibition.
    Genes Dev., 2002. 16(5): p. 646-58
    [PMID:11877383]
  6. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  7. Peng J,Harberd NP
    The role of GA-mediated signalling in the control of seed germination.
    Curr. Opin. Plant Biol., 2002. 5(5): p. 376-81
    [PMID:12183174]
  8. Fu X,Harberd NP
    Auxin promotes Arabidopsis root growth by modulating gibberellin response.
    Nature, 2003. 421(6924): p. 740-3
    [PMID:12610625]
  9. Achard P,Vriezen WH,Van Der Straeten D,Harberd NP
    Ethylene regulates arabidopsis development via the modulation of DELLA protein growth repressor function.
    Plant Cell, 2003. 15(12): p. 2816-25
    [PMID:14615596]
  10. Cheng H, et al.
    Gibberellin regulates Arabidopsis floral development via suppression of DELLA protein function.
    Development, 2004. 131(5): p. 1055-64
    [PMID:14973286]
  11. Yu H, et al.
    Floral homeotic genes are targets of gibberellin signaling in flower development.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(20): p. 7827-32
    [PMID:15128937]
  12. Tyler L, et al.
    Della proteins and gibberellin-regulated seed germination and floral development in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 1008-19
    [PMID:15173565]
  13. Strader LC,Ritchie S,Soule JD,McGinnis KM,Steber CM
    Recessive-interfering mutations in the gibberellin signaling gene SLEEPY1 are rescued by overexpression of its homologue, SNEEZY.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(34): p. 12771-6
    [PMID:15308775]
  14. Bassel GW,Zielinska E,Mullen RT,Bewley JD
    Down-regulation of DELLA genes is not essential for germination of tomato, soybean, and Arabidopsis seeds.
    Plant Physiol., 2004. 136(1): p. 2782-9
    [PMID:15347801]
  15. Cao D,Hussain A,Cheng H,Peng J
    Loss of function of four DELLA genes leads to light- and gibberellin-independent seed germination in Arabidopsis.
    Planta, 2005. 223(1): p. 105-13
    [PMID:16034591]
  16. Hussain A,Cao D,Cheng H,Wen Z,Peng J
    Identification of the conserved serine/threonine residues important for gibberellin-sensitivity of Arabidopsis RGL2 protein.
    Plant J., 2005. 44(1): p. 88-99
    [PMID:16167898]
  17. Ward JM, et al.
    A new role for the Arabidopsis AP2 transcription factor, LEAFY PETIOLE, in gibberellin-induced germination is revealed by the misexpression of a homologous gene, SOB2/DRN-LIKE.
    Plant Cell, 2006. 18(1): p. 29-39
    [PMID:16339853]
  18. Achard P, et al.
    Integration of plant responses to environmentally activated phytohormonal signals.
    Science, 2006. 311(5757): p. 91-4
    [PMID:16400150]
  19. Nakajima M, et al.
    Identification and characterization of Arabidopsis gibberellin receptors.
    Plant J., 2006. 46(5): p. 880-9
    [PMID:16709201]
  20. Yuan K,Wysocka-Diller J
    Phytohormone signalling pathways interact with sugars during seed germination and seedling development.
    J. Exp. Bot., 2006. 57(12): p. 3359-67
    [PMID:16916886]
  21. Penfield S,Gilday AD,Halliday KJ,Graham IA
    DELLA-mediated cotyledon expansion breaks coat-imposed seed dormancy.
    Curr. Biol., 2006. 16(23): p. 2366-70
    [PMID:17141619]
  22. Carrera E, et al.
    Gene expression profiling reveals defined functions of the ATP-binding cassette transporter COMATOSE late in phase II of germination.
    Plant Physiol., 2007. 143(4): p. 1669-79
    [PMID:17322332]
  23. Hussain A,Cao D,Peng J
    Identification of conserved tyrosine residues important for gibberellin sensitivity of Arabidopsis RGL2 protein.
    Planta, 2007. 226(2): p. 475-83
    [PMID:17333251]
  24. Ariizumi T,Steber CM
    Seed germination of GA-insensitive sleepy1 mutants does not require RGL2 protein disappearance in Arabidopsis.
    Plant Cell, 2007. 19(3): p. 791-804
    [PMID:17384169]
  25. Gan Y,Yu H,Peng J,Broun P
    Genetic and molecular regulation by DELLA proteins of trichome development in Arabidopsis.
    Plant Physiol., 2007. 145(3): p. 1031-42
    [PMID:17704233]
  26. Toh S, et al.
    High temperature-induced abscisic acid biosynthesis and its role in the inhibition of gibberellin action in Arabidopsis seeds.
    Plant Physiol., 2008. 146(3): p. 1368-85
    [PMID:18162586]
  27. Feng S, et al.
    Coordinated regulation of Arabidopsis thaliana development by light and gibberellins.
    Nature, 2008. 451(7177): p. 475-9
    [PMID:18216856]
  28. Kim SG,Lee AK,Yoon HK,Park CM
    A membrane-bound NAC transcription factor NTL8 regulates gibberellic acid-mediated salt signaling in Arabidopsis seed germination.
    Plant J., 2008. 55(1): p. 77-88
    [PMID:18363782]
  29. Achard P,Renou JP,Berthomé R,Harberd NP,Genschik P
    Plant DELLAs restrain growth and promote survival of adversity by reducing the levels of reactive oxygen species.
    Curr. Biol., 2008. 18(9): p. 656-60
    [PMID:18450450]
  30. Navarro L, et al.
    DELLAs control plant immune responses by modulating the balance of jasmonic acid and salicylic acid signaling.
    Curr. Biol., 2008. 18(9): p. 650-5
    [PMID:18450451]
  31. Piskurewicz U, et al.
    The gibberellic acid signaling repressor RGL2 inhibits Arabidopsis seed germination by stimulating abscisic acid synthesis and ABI5 activity.
    Plant Cell, 2008. 20(10): p. 2729-45
    [PMID:18941053]
  32. Maymon I, et al.
    Cytosolic activity of SPINDLY implies the existence of a DELLA-independent gibberellin-response pathway.
    Plant J., 2009. 58(6): p. 979-88
    [PMID:19228341]
  33. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  34. Suzuki H, et al.
    Differential expression and affinities of Arabidopsis gibberellin receptors can explain variation in phenotypes of multiple knock-out mutants.
    Plant J., 2009. 60(1): p. 48-55
    [PMID:19500306]
  35. Piskurewicz U,Tureckov√° V,Lacombe E,Lopez-Molina L
    Far-red light inhibits germination through DELLA-dependent stimulation of ABA synthesis and ABI3 activity.
    EMBO J., 2009. 28(15): p. 2259-71
    [PMID:19556968]
  36. Wang F, et al.
    Biochemical insights on degradation of Arabidopsis DELLA proteins gained from a cell-free assay system.
    Plant Cell, 2009. 21(8): p. 2378-90
    [PMID:19717618]
  37. Gallego-Bartolomé J, et al.
    Transcriptional diversification and functional conservation between DELLA proteins in Arabidopsis.
    Mol. Biol. Evol., 2010. 27(6): p. 1247-56
    [PMID:20093430]
  38. Arnaud N, et al.
    Gibberellins control fruit patterning in Arabidopsis thaliana.
    Genes Dev., 2010. 24(19): p. 2127-32
    [PMID:20889713]
  39. Lee KP,Piskurewicz U,Tureckov
    A seed coat bedding assay shows that RGL2-dependent release of abscisic acid by the endosperm controls embryo growth in Arabidopsis dormant seeds.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(44): p. 19108-13
    [PMID:20956298]
  40. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  41. Hou X,Lee LY,Xia K,Yan Y,Yu H
    DELLAs modulate jasmonate signaling via competitive binding to JAZs.
    Dev. Cell, 2010. 19(6): p. 884-94
    [PMID:21145503]
  42. Ariizumi T,Lawrence PK,Steber CM
    The role of two f-box proteins, SLEEPY1 and SNEEZY, in Arabidopsis gibberellin signaling.
    Plant Physiol., 2011. 155(2): p. 765-75
    [PMID:21163960]
  43. Josse EM, et al.
    A DELLA in disguise: SPATULA restrains the growth of the developing Arabidopsis seedling.
    Plant Cell, 2011. 23(4): p. 1337-51
    [PMID:21478445]
  44. Feurtado JA, et al.
    The Arabidopsis C2H2 zinc finger INDETERMINATE DOMAIN1/ENHYDROUS promotes the transition to germination by regulating light and hormonal signaling during seed maturation.
    Plant Cell, 2011. 23(5): p. 1772-94
    [PMID:21571950]
  45. Li KL, et al.
    GsGASA1 mediated root growth inhibition in response to chronic cold stress is marked by the accumulation of DELLAs.
    J. Plant Physiol., 2011. 168(18): p. 2153-60
    [PMID:21855169]
  46. Footitt S,Douterelo-Soler I,Clay H,Finch-Savage WE
    Dormancy cycling in Arabidopsis seeds is controlled by seasonally distinct hormone-signaling pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(50): p. 20236-41
    [PMID:22128331]
  47. Hong GJ,Xue XY,Mao YB,Wang LJ,Chen XY
    Arabidopsis MYC2 interacts with DELLA proteins in regulating sesquiterpene synthase gene expression.
    Plant Cell, 2012. 24(6): p. 2635-48
    [PMID:22669881]
  48. Li QF, et al.
    An interaction between BZR1 and DELLAs mediates direct signaling crosstalk between brassinosteroids and gibberellins in Arabidopsis.
    Sci Signal, 2012. 5(244): p. ra72
    [PMID:23033541]
  49. Stamm P, et al.
    Insights into the molecular mechanism of RGL2-mediated inhibition of seed germination in Arabidopsis thaliana.
    BMC Plant Biol., 2012. 12: p. 179
    [PMID:23035751]
  50. Park J,Nguyen KT,Park E,Jeon JS,Choi G
    DELLA proteins and their interacting RING Finger proteins repress gibberellin responses by binding to the promoters of a subset of gibberellin-responsive genes in Arabidopsis.
    Plant Cell, 2013. 25(3): p. 927-43
    [PMID:23482857]
  51. Footitt S,Huang Z,Clay HA,Mead A,Finch-Savage WE
    Temperature, light and nitrate sensing coordinate Arabidopsis seed dormancy cycling, resulting in winter and summer annual phenotypes.
    Plant J., 2013. 74(6): p. 1003-15
    [PMID:23590427]
  52. Sarnowska EA, et al.
    DELLA-interacting SWI3C core subunit of switch/sucrose nonfermenting chromatin remodeling complex modulates gibberellin responses and hormonal cross talk in Arabidopsis.
    Plant Physiol., 2013. 163(1): p. 305-17
    [PMID:23893173]
  53. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]
  54. Rombol
    Arabidopsis DELLA and two HD-ZIP transcription factors regulate GA signaling in the epidermis through the L1 box cis-element.
    Plant Cell, 2014. 26(7): p. 2905-19
    [PMID:24989044]
  55. Hou X, et al.
    Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis.
    Nat Commun, 2014. 5: p. 4601
    [PMID:25105952]
  56. Davi
    Class I TCP-DELLA interactions in inflorescence shoot apex determine plant height.
    Curr. Biol., 2014. 24(16): p. 1923-8
    [PMID:25127215]
  57. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]