PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G03260.1
Common NameHDG8, HDGL2-8, T17B22.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 699aa    MW: 78426.2 Da    PI: 6.3178
Description homeodomain GLABROUS 8
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G03260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-192579256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 r+ +++t++q+++Le++F+++++p++++r +L ++l+L+ +q+k+WFqN+R++ k
  AT3G03260.1 25 RTCHRHTPQQIQRLEAYFKECPHPDERQRNQLCRELKLEPDQIKFWFQNKRTQSK 79
                 555689**********************************************998 PP

2START116.53.7e-372144352206
                  HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                  +a +a +el ++ laee++Wvks    +  + +e++ +     +            ++e ++a++vv  ++ +l + +ld   +W+e ++    ka t
  AT3G03260.1 214 IAASAVEELKRLFLAEEQFWVKSCideTYVIDTESYER-----FshavkhfssttAHVESSKAVTVVHVEAINLIQMFLDPE-KWKELFPtivnKANT 305
                  7889999*****************65533334444444.....3334567888889********************999999.******99999**** PP

                  EEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
        START  82 levissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                  + v+ sg       ++lq+m  +l  lsplvp R+f++vR++++ ++g w+i+d  v+++++     + + + ++pSg+li+ +++ hskv w+ehv+
  AT3G03260.1 306 IHVLGSGlpirgncNVLQVMWEQLHILSPLVPaREFMVVRCCQEIEKGIWIIAD--VSHRANFD--FGNAACYKRPSGCLIQALPDAHSKVMWIEHVE 399
                  ******************************************************..55666653..46688899************************ PP

                  --SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                  ++ +l  h ++r l++ g   gak+w  tl+r ce+
  AT3G03260.1 400 VDHKLDtHKIYRDLLSGGSGYGAKRWIVTLERMCER 435
                  *****99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-191082IPR009057Homeodomain-like
SuperFamilySSF466894.71E-181081IPR009057Homeodomain-like
SMARTSM003891.3E-152185IPR001356Homeobox domain
PROSITE profilePS5007116.2612181IPR001356Homeobox domain
CDDcd000866.10E-172482No hitNo description
PfamPF000461.9E-162679IPR001356Homeobox domain
PROSITE profilePS5084841.192204438IPR002913START domain
CDDcd088755.18E-97208434No hitNo description
SuperFamilySSF559611.03E-25209436No hitNo description
SMARTSM002349.6E-22213435IPR002913START domain
PfamPF018521.9E-30214435IPR002913START domain
Gene3DG3DSA:3.30.530.206.2E-5253403IPR023393START-like domain
SuperFamilySSF559612.33E-11455664No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009089anatomyendosperm
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MDNNGGGSSG NEQYTSGDAK QNGKRTCHRH TPQQIQRLEA YFKECPHPDE RQRNQLCREL  60
KLEPDQIKFW FQNKRTQSKT QEDRSTNVLL RGENETLQSD NEAMLDALKS VLCPACGGPP  120
FGREERGHNL QKLRFENARL KDHRDRISNF VDQHKPNEPT VEDSLAYVPS LDRISYGING  180
GNMYEPSSSY GPPNFQIIQP RPLAETDMSL LSEIAASAVE ELKRLFLAEE QFWVKSCIDE  240
TYVIDTESYE RFSHAVKHFS STTAHVESSK AVTVVHVEAI NLIQMFLDPE KWKELFPTIV  300
NKANTIHVLG SGLPIRGNCN VLQVMWEQLH ILSPLVPARE FMVVRCCQEI EKGIWIIADV  360
SHRANFDFGN AACYKRPSGC LIQALPDAHS KVMWIEHVEV DHKLDTHKIY RDLLSGGSGY  420
GAKRWIVTLE RMCERMALSS IQTLPPSDRS EVITTGEARR SVMKLGERMV KNFNEMLTMS  480
GKIDFPQQSK NGVRVSIRMN IEAGQPPGIV VSASSSLAIP LTPLQVFAFL QNLDTRQQWD  540
ILSYGTVVNE IARIVTGSSE TNCVTILRVH PTHEENNDKM VVQDSCKDDM LMLQDCYMDA  600
LGGMIVYAPM DMATMHFAVS GEVDPSHIPI LPSGFVISSD GRRSTVEDGG TLLTVAFQIL  660
VSGKANRSRE VNEKSVDTVS ALISSTIQRI KGLLNCPEC
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306788020.0
Genevisible258872_at0.0
Expression AtlasAT3G03260-
AtGenExpressAT3G03260-
ATTED-IIAT3G03260-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the embryo at early stage and in the endosperm. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G03260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G03260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1178670.0AK117867.1 Arabidopsis thaliana At3g03260 mRNA for unknown protein, complete cds, clone: RAFL19-04-D14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186976.20.0homeobox-leucine zipper protein HDG8
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
MalvidsOGEM127911530
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  5. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  6. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  7. Kawanabe T,Fujimoto R,Sasaki T,Taylor JM,Dennis ES
    A comparison of transcriptome and epigenetic status between closely related species in the genus Arabidopsis.
    Gene, 2012. 506(2): p. 301-9
    [PMID:22796129]