PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G03200.1
Common Nameanac045, NAC045, T17B22.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 479aa    MW: 55587.6 Da    PI: 5.3407
Description NAC domain containing protein 45
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G03200.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761.1e-5461331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeel+++yLk+k++g ++el evi+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWkatgkd++v   +
  AT3G03200.1   6 LPPGFRFHPTDEELITYYLKRKINGLEIEL-EVIAEVDLYKCEPWDLPgKsLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSW-R 101
                  79****************************.99***************6345667999*************************************9.8 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLv+y+grap+g +t Wvmheyrl
  AT3G03200.1 102 DRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                  899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-634157IPR003441NAC domain
PROSITE profilePS5100561.0256157IPR003441NAC domain
PfamPF023657.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0090602Biological Processsieve element enucleation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009029anatomystamen
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING LEIELEVIAE VDLYKCEPWD LPGKSLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDETECEP SAYGMQDAYA LCRVFKKIVI EAKPRDQHRS YVHAMSNVSG  180
NCSSSFDTCS DLEISSTTHQ VQNTFQPRFG NERFNSNAIS NEDWSQYYGS SYRPFPTPYK  240
VNTEIECSML QHNIYLPPLR VENSAFSDSD FFTSMTHNND HGVFDDFTFA ASNSNHNNSV  300
GDQVIHVGNY DEQLITSNRH MNQTGYIKEQ KIRSSLDNTD EDPGFHGNNT NDNIDIDDFL  360
SFDIYNEDNV NQIEDNEDVN TNETLDSSGF EVVEEETRFN NQMLISTYQT TKILYHQVVP  420
CHTLKVHVNP ISHNVEERTL FIEEDKDSWL QRAEKITKTK LTLFSLMAQQ YYKCLAIFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-55115712165NAC domain-containing protein 19
4dul_A2e-55115712165NAC domain-containing protein 19
1ut7_B2e-55115712165NO APICAL MERISTEM PROTEIN
1ut7_A2e-55115712165NO APICAL MERISTEM PROTEIN
1ut4_B2e-55115712165NO APICAL MERISTEM PROTEIN
1ut4_A2e-55115712165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.410170.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865097090.0
Genevisible258865_at0.0
Expression AtlasAT3G03200-
AtGenExpressAT3G03200-
ATTED-IIAT3G03200-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Function -- GeneRIF ? help Back to Top
  1. NAC45/86 orchestrate the enucleation, perinuclear organelle clustering, shift in NEN1 and NEN2 localization, and cytosol degradation by regulating the expression of a set of target genes, including NEN1, NEN2, and NEN4.
    [PMID: 25081480]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00329DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G03200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch A4VCM0
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype, due to the redundancy with NAC086 (AC Q9FFI5). Nac045 and nac086 double mutants exhibit seedling lethality with defective development of the protophloem sieve element. {ECO:0000269|PubMed:25081480}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G03200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0304610.0BT030461.1 Arabidopsis thaliana At3g03200 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186970.20.0NAC domain containing protein 45
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLD7L0E40.0D7L0E4_ARALL; Predicted protein
STRINGAT3G03200.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM44111852
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  4. Furuta KM, et al.
    Plant development. Arabidopsis NAC45/86 direct sieve element morphogenesis culminating in enucleation.
    Science, 2014. 345(6199): p. 933-7
    [PMID:25081480]