PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G02380.1
Common NameATCOL2, BBX3, COL2, F11A12.106, F11A12.7, F16B3.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 347aa    MW: 38523.7 Da    PI: 5.6369
Description CONSTANS-like 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G02380.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.83.4e-061456440
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 r C+++ +   + +Ce ++ +lC +C    H        H++v
  AT3G02380.1 14 RACDTCRSAACTVYCEADSAYLCTTCDARVHAAnrvasrHERV 56
                 57******99******************999556677778766 PP

2zf-B_box32.42e-1056101342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                   r+C+ +e+ ++ + C+ +   lC  C  e+H+       H++vp+
  AT3G02380.1  56 VRVCQSCESAPAAFLCKADAASLCTACDAEIHSAnplarrHQRVPI 101
                  689*****************************66899999**9997 PP

3CCT68.51.8e-23278320143
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                  Rea++lRY+eK+ktRkF+K+irY+sRKa+Ae RpR+KGrF+k+
  AT3G02380.1 278 REARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKR 320
                  9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7791158IPR000315B-box-type zinc finger
SMARTSM003362.0E-81158IPR000315B-box-type zinc finger
CDDcd000214.66E-81458No hitNo description
PROSITE profilePS5011911.66154101IPR000315B-box-type zinc finger
PfamPF006435.1E-856101IPR000315B-box-type zinc finger
CDDcd000216.31E-957101No hitNo description
SMARTSM003365.0E-1159101IPR000315B-box-type zinc finger
PROSITE profilePS5101716.44278320IPR010402CCT domain
PfamPF062033.2E-17278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MLKEESNESG TWARACDTCR SAACTVYCEA DSAYLCTTCD ARVHAANRVA SRHERVRVCQ  60
SCESAPAAFL CKADAASLCT ACDAEIHSAN PLARRHQRVP ILPLSANSCS SMAPSETDAD  120
NDEDDREVAS WLLPNPGKNI GNQNNGFLFG VEYLDLVDYS SSMDNQFEDN QYTHYQRSFG  180
GDGVVPLQVE ESTSHLQQSQ QNFQLGINYG FSSGAHYNNN SLKDLNHSAS VSSMDISVVP  240
ESTASDITVQ HPRTTKETID QLSGPPTQVV QQLTPMEREA RVLRYREKKK TRKFDKTIRY  300
ASRKAYAEIR PRIKGRFAKR IETEAEAEEI FSTSLMSETG YGIVPSF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.103730.0leaf| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453380160.0
Genevisible258497_at0.0
Expression AtlasAT3G02380-
AtGenExpressAT3G02380-
ATTED-IIAT3G02380-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves. Expressed at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
TAIRhomologous to the flowering-time gene CONSTANS (CO) encoding zinc-finger proteins
UniProtPutative transcription factor. Does not affect flowering time.
Function -- GeneRIF ? help Back to Top
  1. The lack of flowering promotion activity by COL1 and COL2 is mainly attributed to the differences between CO and the COL1 and COL2 proteins in the amino acid sequence encoded by their first exons.
    [PMID: 23265320]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G02380.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q96502
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G02380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3701490.0AF370149.1 Arabidopsis thaliana putative flowering-time gene CONSTANS protein COL2 (At3g02380) mRNA, complete cds.
GenBankAY0590920.0AY059092.1 Arabidopsis thaliana putative flowering-time gene CONSTANS protein COL2 (At3g02380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186887.10.0CONSTANS-like 2
SwissprotQ965020.0COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A178VE790.0A0A178VE79_ARATH; COL2
STRINGAT3G02380.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Representative plantOGRP6911767
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ledger S,Strayer C,Ashton F,Kay SA,Putterill J
    Analysis of the function of two circadian-regulated CONSTANS-LIKE genes.
    Plant J., 2001. 26(1): p. 15-22
    [PMID:11359606]
  3. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  4. Goff SA, et al.
    A draft sequence of the rice genome (Oryza sativa L. ssp. japonica).
    Science, 2002. 296(5565): p. 92-100
    [PMID:11935018]
  5. Izawa T,Takahashi Y,Yano M
    Comparative biology comes into bloom: genomic and genetic comparison of flowering pathways in rice and Arabidopsis.
    Curr. Opin. Plant Biol., 2003. 6(2): p. 113-20
    [PMID:12667866]
  6. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  9. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  10. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  11. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  12. Hannah MA,Heyer AG,Hincha DK
    A global survey of gene regulation during cold acclimation in Arabidopsis thaliana.
    PLoS Genet., 2005. 1(2): p. e26
    [PMID:16121258]
  13. Wang J, et al.
    Genomewide nonadditive gene regulation in Arabidopsis allotetraploids.
    Genetics, 2006. 172(1): p. 507-17
    [PMID:16172500]
  14. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  15. Schranz ME,Mitchell-Olds T
    Independent ancient polyploidy events in the sister families Brassicaceae and Cleomaceae.
    Plant Cell, 2006. 18(5): p. 1152-65
    [PMID:16617098]
  16. Khanna R, et al.
    Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation.
    Plant Cell, 2006. 18(9): p. 2157-71
    [PMID:16891401]
  17. Thomas BC,Rapaka L,Lyons E,Pedersen B,Freeling M
    Arabidopsis intragenomic conserved noncoding sequence.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(9): p. 3348-53
    [PMID:17301222]
  18. Chia TY,M
    Sugar beet contains a large CONSTANS-LIKE gene family including a CO homologue that is independent of the early-bolting (B) gene locus.
    J. Exp. Bot., 2008. 59(10): p. 2735-48
    [PMID:18495636]
  19. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  20. Charron JB,Ouellet F,Houde M,Sarhan F
    The plant Apolipoprotein D ortholog protects Arabidopsis against oxidative stress.
    BMC Plant Biol., 2008. 8: p. 86
    [PMID:18671872]
  21. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  22. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  23. Ruckle ME,Burgoon LD,Lawrence LA,Sinkler CA,Larkin RM
    Plastids are major regulators of light signaling in Arabidopsis.
    Plant Physiol., 2012. 159(1): p. 366-90
    [PMID:22383539]
  24. Kim SK,Park HY,Jang YH,Lee JH,Kim JK
    The sequence variation responsible for the functional difference between the CONSTANS protein, and the CONSTANS-like (COL) 1 and COL2 proteins, resides mostly in the region encoded by their first exons.
    Plant Sci., 2013. 199-200: p. 71-8
    [PMID:23265320]
  25. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  26. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]