PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G01970.1
Common NameATWRKY45, F1C9.25, F28J7.30, WRKY45
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 147aa    MW: 17225.4 Da    PI: 9.2058
Description WRKY DNA-binding protein 45
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G01970.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.93.1e-3164122159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK vk+++fprsYY+Ct +gC+vkk+v+r+  d+ vv++tY+g H+h 
  AT3G01970.1  64 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEEGCRVKKQVQRQWGDEGVVVTTYQGVHTHA 122
                  59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.7E-3349122IPR003657WRKY domain
SuperFamilySSF1182902.22E-2856123IPR003657WRKY domain
PROSITE profilePS5081129.83859124IPR003657WRKY domain
SMARTSM007744.7E-3664123IPR003657WRKY domain
PfamPF031062.4E-2565121IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006817Biological Processphosphate ion transport
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MEDRRCDVLF PCSSSVDPRL TEFHGVDNSA QPTTSSEEKP RSKKKKKERE ARYAFQTRSQ  60
VDILDDGYRW RKYGQKAVKN NPFPRSYYKC TEEGCRVKKQ VQRQWGDEGV VVTTYQGVHT  120
HAVDKPSDNF HHILTQMHIF PPFCLKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-2754121774Probable WRKY transcription factor 4
1wj2_A1e-2754121774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.265980.0leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453379980.0
Genevisible258975_at0.0
Expression AtlasAT3G01970-
AtGenExpressAT3G01970-
ATTED-IIAT3G01970-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group I
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WRKY45 is involved in Arabidopsis response to phosphate starvation by direct up-regulation of PHT1;1 expression.
    [PMID: 24586044]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00325DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G01970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G01970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0246840.0BT024684.1 Arabidopsis thaliana At3g01970 mRNA, complete cds.
GenBankAK1184570.0AK118457.1 Arabidopsis thaliana At3g01970 mRNA for putative WRKY-like transcriptional regulator protein, complete cds, clone: RAFL19-70-A15.
GenBankAF4262510.0AF426251.1 Arabidopsis thaliana WRKY transcription factor 45 (WRKY45) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186846.11e-109WRKY DNA-binding protein 45
SwissprotQ9S7631e-111WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBLQ29Q721e-109Q29Q72_ARATH; At3g01970
STRINGAT3G01970.11e-108(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MalvidsOGEM50928154
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Hass C, et al.
    The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.
    EMBO J., 2004. 23(16): p. 3290-302
    [PMID:15282545]
  5. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  6. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  7. Nicola
    Large-scale analysis of mRNA translation states during sucrose starvation in arabidopsis cells identifies cell proliferation and chromatin structure as targets of translational control.
    Plant Physiol., 2006. 141(2): p. 663-73
    [PMID:16632591]
  8. Tosti N, et al.
    Gene expression profiles of O3-treated Arabidopsis plants.
    Plant Cell Environ., 2006. 29(9): p. 1686-702
    [PMID:16913859]
  9. van de Mortel JE, et al.
    Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens.
    Plant Physiol., 2006. 142(3): p. 1127-47
    [PMID:16998091]
  10. Lou Y,Gou JY,Xue HW
    PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth.
    Plant Cell, 2007. 19(1): p. 163-81
    [PMID:17220200]
  11. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  12. Shimono M, et al.
    Rice WRKY45 plays a crucial role in benzothiadiazole-inducible blast resistance.
    Plant Cell, 2007. 19(6): p. 2064-76
    [PMID:17601827]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Jiang CJ, et al.
    Suppression of the rice fatty-acid desaturase gene OsSSI2 enhances resistance to blast and leaf blight diseases in rice.
    Mol. Plant Microbe Interact., 2009. 22(7): p. 820-9
    [PMID:19522564]
  15. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  16. Matsushita A, et al.
    Nuclear ubiquitin proteasome degradation affects WRKY45 function in the rice defense program.
    Plant J., 2013. 73(2): p. 302-13
    [PMID:23013464]
  17. Wang H, et al.
    Arabidopsis WRKY45 transcription factor activates PHOSPHATE TRANSPORTER1;1 expression in response to phosphate starvation.
    Plant Physiol., 2014. 164(4): p. 2020-9
    [PMID:24586044]
  18. Axelos M, et al.
    The gene family encoding the Arabidopsis thaliana translation elongation factor EF-1 alpha: molecular cloning, characterization and expression.
    Mol. Gen. Genet., 1989. 219(1-2): p. 106-12
    [PMID:2615757]