PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G01470.1
Common NameATHB1, ATHB-1, F4P13.2, HAT5, HB-1, HD-ZIP-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 272aa    MW: 30933.1 Da    PI: 4.5368
Description homeobox 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G01470.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.11.9e-2068121356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  AT3G01470.1  68 KKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 121
                  56789************************************************9 PP

2HD-ZIP_I/II133.95.6e-4367159193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl++eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++  ++++Lr+e+++
  AT3G01470.1  67 EKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTS 159
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.29E-2054125IPR009057Homeodomain-like
PROSITE profilePS5007118.0163123IPR001356Homeobox domain
SMARTSM003891.6E-1966127IPR001356Homeobox domain
PfamPF000461.7E-1768121IPR001356Homeobox domain
CDDcd000868.91E-1968124No hitNo description
Gene3DG3DSA:1.10.10.607.5E-2269130IPR009057Homeodomain-like
PRINTSPR000314.0E-694103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000314.0E-6103119IPR000047Helix-turn-helix motif
PfamPF021831.3E-16123165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MESNSFFFDP SASHGNSMFF LGNLNPVVQG GGARSMMNME ETSKRRPFFS SPEDLYDDDF  60
YDDQLPEKKR RLTTEQVHLL EKSFETENKL EPERKTQLAK KLGLQPRQVA VWFQNRRARW  120
KTKQLERDYD LLKSTYDQLL SNYDSIVMDN DKLRSEVTSL TEKLQGKQET ANEPPGQVPE  180
PNQLDPVYIN AAAIKTEDRL SSGSVGSAVL DDDAPQLLDS CDSYFPSIVP IQDNSNASDH  240
DNDRSCFADV FVPTTSPSHD HHGESLAFWG WP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.478150.0floral meristem| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865096590.0
Genevisible259165_at0.0
Expression AtlasAT3G01470-
AtGenExpressAT3G01470-
ATTED-IIAT3G01470-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain leucine zipper class I (HD-Zip I) transcriptional activator involved in leaf development.
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Function -- GeneRIF ? help Back to Top
  1. AtHB1 was highly expressed throughout in pavement, basal and trichome cells.
    [PMID: 20101514]
  2. The results suggest that AtHB1 acts downstream of PIF1 to promote hypocotyl elongation, especially in response to short-day photoperiods.
    [PMID: 25865500]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G01470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G07900(R), AT2G19590(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G01470
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G01470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0989720.0AY098972.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankAY0581880.0AY058188.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankX588210.0X58821.1 A.thaliana homeobox gene Athb-1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186796.10.0homeobox-leucine zipper protein HAT5
SwissprotQ022830.0HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLD7L9P61e-174D7L9P6_ARALL; Homeobox-leucine zipper protein hat5
STRINGAT3G01470.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MalvidsOGEM88842738
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Schena M,Davis RW
    HD-Zip proteins: members of an Arabidopsis homeodomain protein superfamily.
    Proc. Natl. Acad. Sci. U.S.A., 1992. 89(9): p. 3894-8
    [PMID:1349174]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  6. Ruberti I,Sessa G,Lucchetti S,Morelli G
    A novel class of plant proteins containing a homeodomain with a closely linked leucine zipper motif.
    EMBO J., 1991. 10(7): p. 1787-91
    [PMID:1675603]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Vrebalov J, et al.
    Fleshy fruit expansion and ripening are regulated by the Tomato SHATTERPROOF gene TAGL1.
    Plant Cell, 2009. 21(10): p. 3041-62
    [PMID:19880793]
  9. Itkin M, et al.
    TOMATO AGAMOUS-LIKE 1 is a component of the fruit ripening regulatory network.
    Plant J., 2009. 60(6): p. 1081-95
    [PMID:19891701]
  10. Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
    Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana.
    Protoplasma, 2010. 241(1-4): p. 29-36
    [PMID:20101514]
  11. Ariel F, et al.
    Environmental regulation of lateral root emergence in Medicago truncatula requires the HD-Zip I transcription factor HB1.
    Plant Cell, 2010. 22(7): p. 2171-83
    [PMID:20675575]
  12. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  13. Zhang Y, et al.
    Over-expression of WOX1 leads to defects in meristem development and polyamine homeostasis in Arabidopsis.
    J Integr Plant Biol, 2011. 53(6): p. 493-506
    [PMID:21658178]
  14. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  15. Capella M,R
    Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB.
    Plant Cell Rep., 2014. 33(6): p. 955-67
    [PMID:24531799]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Capella M,Ribone PA,Arce AL,Chan RL
    Arabidopsis thaliana HomeoBox 1 (AtHB1), a Homedomain-Leucine Zipper I (HD-Zip I) transcription factor, is regulated by PHYTOCHROME-INTERACTING FACTOR 1 to promote hypocotyl elongation.
    New Phytol., 2015. 207(3): p. 669-82
    [PMID:25865500]
  18. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]
  19. Sessa G,Morelli G,Ruberti I
    The Athb-1 and -2 HD-Zip domains homodimerize forming complexes of different DNA binding specificities.
    EMBO J., 1993. 12(9): p. 3507-17
    [PMID:8253077]
  20. Aoyama T, et al.
    Ectopic expression of the Arabidopsis transcriptional activator Athb-1 alters leaf cell fate in tobacco.
    Plant Cell, 1995. 7(11): p. 1773-85
    [PMID:8535134]
  21. Sessa G,Morelli G,Ruberti I
    DNA-binding specificity of the homeodomain-leucine zipper domain.
    J. Mol. Biol., 1997. 274(3): p. 303-9
    [PMID:9405140]