PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G47810.1
Common NameF17A22.20, NFYB5, NF-YB5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 160aa    MW: 18122.3 Da    PI: 6.9529
Description nuclear factor Y, subunit B5
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G47810.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.91.6e-5449145197
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  v+eqdr+lPianv+rimk++lPanak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+++lk+yl++yr legek
  AT2G47810.1  49 VKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEK 145
                  58********************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-5242152IPR009072Histone-fold
SuperFamilySSF471131.86E-3952154IPR009072Histone-fold
PfamPF008081.1E-2755119IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.8E-1883101No hitNo description
PROSITE patternPS00685086102IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.8E-18102120No hitNo description
PRINTSPR006154.8E-18121139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0025281anatomypollen
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MAGNYHSFQN PIPRYQNYNF GSSSSNHQHE HDGLVVVVED QQQEESMMVK EQDRLLPIAN  60
VGRIMKNILP ANAKVSKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDICWAMA  120
NLGFDDYAAQ LKKYLHRYRV LEGEKPNHHG KGGPKSSPDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4349139191Transcription factor HapC (Eurofung)
4g92_B1e-4349139191Transcription factor HapC (Eurofung)
5g49_A2e-4347139496NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257371_at0.0
Expression AtlasAT2G47810-
AtGenExpressAT2G47810-
ATTED-IIAT2G47810-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G47810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G09030, AT1G54830, AT1G56170
IntActSearch O82248
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G47810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0053090.0AC005309.3 Arabidopsis thaliana chromosome 2 clone F17A22 map CIC06C03, complete sequence.
GenBankBT0039680.0BT003968.1 Arabidopsis thaliana clone RAFL15-27-K05 (R20859) putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds.
GenBankBT0050810.0BT005081.1 Arabidopsis thaliana clone U20859 putative CCAAT-box binding trancription factor (At2g47810) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182302.11e-119nuclear factor Y, subunit B5
SwissprotO822481e-120NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A178VUG01e-118A0A178VUG0_ARATH; NF-YB5
STRINGAT2G47810.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Representative plantOGRP16817170
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Kwong RW, et al.
    LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
    Plant Cell, 2003. 15(1): p. 5-18
    [PMID:12509518]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  7. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  8. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]
  9. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]