PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G47260.1
Common NameATWRKY23, T8I13.10, WRKY23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 337aa    MW: 37684.7 Da    PI: 6.9536
Description WRKY DNA-binding protein 23
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G47260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.7e-33174230258
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h
  AT2G47260.1 174 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTH 230
                  8******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381305.7E-1291337IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.9E-34158232IPR003657WRKY domain
SuperFamilySSF1182901.7E-28165231IPR003657WRKY domain
PROSITE profilePS5081130.963168233IPR003657WRKY domain
SMARTSM007741.0E-38173232IPR003657WRKY domain
PfamPF031067.7E-26174230IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEFTDFSKTS FYYPSSQSVW DFGDLAAAER HSLGFMELLS SQQHQDFATV SPHSFLLQTS  60
QPQTQTQPSA KLSSSIIQAP PSEQLVTSKV ESLCSDHLLI NPPATPNSSS ISSASSEALN  120
EEKPKTEDNE EEGGEDQQEK SHTKKQLKAK KNNQKRQREA RVAFMTKSEV DHLEDGYRWR  180
KYGQKAVKNS PFPRSYYRCT TASCNVKKRV ERSFRDPSTV VTTYEGQHTH ISPLTSRPIS  240
TGGFFGSSGA ASSLGNGCFG FPIDGSTLIS PQFQQLVQYH HQQQQQELMS CFGGVNEYLN  300
SHANEYGDDN RVKKSRVLVK DNGLLQDVVP SHMLKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-28163233777Probable WRKY transcription factor 4
2lex_A4e-28163233777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.248670.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425700030.0
Genevisible260528_at0.0
Expression AtlasAT2G47260-
AtGenExpressAT2G47260-
ATTED-IIAT2G47260-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of WRKY Transcription Factor; Group I. Involved in nematode feeding site establishment.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WRKY23 is expressed during the early stages of nematode feeding site establishment.
    [PMID: 18599655]
  2. results suggest a model in which WRKY23 is part of a transcriptional feedback loop of auxin on its own transport through local regulation of flavonol biosynthesis
    [PMID: 22307611]
  3. Knocking down WRKY23 transcript levels or expression of a dominant-negative WRKY23 affected both apical-basal axis formation as well as installation of the root stem cell niche.
    [PMID: 24157946]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G47260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch O22900
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G47260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0062380.0BT006238.1 Arabidopsis thaliana At2g47260 mRNA, complete cds.
GenBankAY0526470.0AY052647.1 Arabidopsis thaliana WRKY transcription factor 23 (WRKY23) mRNA, complete cds.
GenBankAK1179180.0AK117918.1 Arabidopsis thaliana At2g47260 mRNA for putative WRKY-type DNA binding protein, complete cds, clone: RAFL19-10-C13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182248.10.0WRKY DNA-binding protein 23
SwissprotO229000.0WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLD7LGL40.0D7LGL4_ARALL; Predicted protein
STRINGAT2G47260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MalvidsOGEM61522647
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Rashotte AM,Carson SD,To JP,Kieber JJ
    Expression profiling of cytokinin action in Arabidopsis.
    Plant Physiol., 2003. 132(4): p. 1998-2011
    [PMID:12913156]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  7. Ohashi-Ito K,Kubo M,Demura T,Fukuda H
    Class III homeodomain leucine-zipper proteins regulate xylem cell differentiation.
    Plant Cell Physiol., 2005. 46(10): p. 1646-56
    [PMID:16081527]
  8. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  9. Grunewald W, et al.
    A role for AtWRKY23 in feeding site establishment of plant-parasitic nematodes.
    Plant Physiol., 2008. 148(1): p. 358-68
    [PMID:18599655]
  10. Lev
    Expression profiling and functional analysis of Populus WRKY23 reveals a regulatory role in defense.
    New Phytol., 2009. 184(1): p. 48-70
    [PMID:19674332]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Grunewald W, et al.
    Transcription factor WRKY23 assists auxin distribution patterns during Arabidopsis root development through local control on flavonol biosynthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(5): p. 1554-9
    [PMID:22307611]
  13. Grunewald W, et al.
    Tightly controlled WRKY23 expression mediates Arabidopsis embryo development.
    EMBO Rep., 2013. 14(12): p. 1136-42
    [PMID:24157946]