PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G47210.1
Common NameSWC4, T8I13.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 441aa    MW: 49823.6 Da    PI: 9.7385
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G47210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.2e-07129171346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eE ++l + ++ +  + +  Ia +++  Rt +++k+r+++
      AT2G47210.1 129 VWTKEETDQLFEFCQNFDLR-FVVIADRFPVSRTVEELKDRYYS 171
                      6*******************.*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162829.5E-30102176IPR032563DAMP1, SANT/Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-6125172IPR009057Homeodomain-like
SuperFamilySSF466897.99E-7125177IPR009057Homeodomain-like
SMARTSM007179.1E-9126175IPR001005SANT/Myb domain
CDDcd116582.79E-19130173No hitNo description
PfamPF054992.6E-7319386IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043967Biological Processhistone H4 acetylation
GO:0043968Biological Processhistone H2A acetylation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003714Molecular Functiontranscription corepressor activity
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MGGTDAKDIL GLPKTPLSLT QEKKSRPQKE SHRKPDGISR EVYALTGGVA PLMPSIDLKR  60
RPPADEKVAW KWLSFTNSAR KDDLQLYHWV RVVNDVPPTG DYSFAKYNKS VDILKYTDEE  120
YENHLTDSVW TKEETDQLFE FCQNFDLRFV VIADRFPVSR TVEELKDRYY SVNRALLRAR  180
AQSPADVANH PLMKEPYDIT RDRERKRALS MVLSQSRHQE KKDAEILAEA KRITEMRLAA  240
RRAEEPDVSA NENAGLDKAD GVVPGRSVSP TSNSQLPATA VAPSTLTMAD YASTLASLRM  300
LHVYLRTYGL EQMVQAASSA VGLRTIKRVE QTLQDLGVNL KPKVPTKTVC DEHLELRKEI  360
LTLLNLQKQL QYKESEGSSH REGSYAAMPD TPKDRVFAPD PFSFGAERPI KKEQKRKGPG  420
RQADTPSPAH KRPRKLKASD L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A1e-18101181488DNA methyltransferase 1-associated protein 1
4iej_A1e-18101181488DNA methyltransferase 1-associated protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.270990.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865088490.0
Expression AtlasAT2G47210-
AtGenExpressAT2G47210-
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Function -- GeneRIF ? help Back to Top
  1. data suggests that SWC4 regulates plant growth and development by aiding SWR1-C recruitment and modulating H2A.Z deposition. [SWC4]
    [PMID: 29604400]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G47210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G47210
IntActSearch Q8VZL6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G47210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0640240.0AY064024.1 Arabidopsis thaliana unknown protein (At2g47210) mRNA, complete cds.
GenBankAY0966100.0AY096610.1 Arabidopsis thaliana unknown protein (At2g47210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001323962.10.0myb-like transcription factor family protein
RefseqNP_001323963.10.0myb-like transcription factor family protein
RefseqNP_850470.10.0myb-like transcription factor family protein
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A178VRI90.0A0A178VRI9_ARATH; Uncharacterized protein
STRINGAT2G47210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85432435
Representative plantOGRP6713810
Publications ? help Back to Top
  1. Boisson B,Giglione C,Meinnel T
    Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote.
    J. Biol. Chem., 2003. 278(44): p. 43418-29
    [PMID:12912986]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  4. Bieluszewski T, et al.
    AtEAF1 is a potential platform protein for Arabidopsis NuA4 acetyltransferase complex.
    BMC Plant Biol., 2015. 15: p. 75
    [PMID:25849764]
  5. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]