PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G46830.1
Common NameAtCCA1, CCA1, F19D11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 608aa    MW: 66975.6 Da    PI: 5.8919
Description circadian clock associated 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G46830.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a +++G   W +I +++  ++t+ q++s+ qk+
      AT2G46830.1 24 RERWTEEEHNRFIEALRLYGRA-WQKIEEHVA-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.32E-161874IPR009057Homeodomain-like
PROSITE profilePS5129421.271973IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-92172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-162271IPR006447Myb domain, plants
SMARTSM007171.0E-122371IPR001005SANT/Myb domain
PfamPF002491.3E-122467IPR001005SANT/Myb domain
CDDcd001671.81E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0019904Molecular Functionprotein domain specific binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000003anatomywhole plant
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
METNSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFIEALR LYGRAWQKIE EHVATKTAVQ  60
IRSHAQKFFS KVEKEAEAKG VAMGQALDIA IPPPRPKRKP NNPYPRKTGS GTILMSKTGV  120
NDGKESLGSE KVSHPEMANE DRQQSKPEEK TLQEDNCSDC FTHQYLSAAS SMNKSCIETS  180
NASTFREFLP SREEGSQNNR VRKESNSDLN AKSLENGNEQ GPQTYPMHIP VLVPLGSSIT  240
SSLSHPPSEP DSHPHTVAGD YQSFPNHIMS TLLQTPALYT AATFASSFWP PDSSGGSPVP  300
GNSPPNLAAM AAATVAAASA WWAANGLLPL CAPLSSGGFT SHPPSTFGPS CDVEYTKAST  360
LQHGSVQSRE QEHSEASKAR SSLDSEDVEN KSKPVCHEQP SATPESDAKG SDGAGDRKQV  420
DRSSCGSNTP SSSDDVEADA SERQEDGTNG EVKETNEDTN KPQTSESNAR RSRISSNITD  480
PWKSVSDEGR IAFQALFSRE VLPQSFTYRE EHREEEQQQQ EQRYPMALDL NFTAQLTPVD  540
DQEEKRNTGF LGIGLDASKL MSRGRTGFKP YKRCSMEAKE SRILNNNPII HVEQKDPKRM  600
RLETQAST
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.109560.0vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266719_at0.0
Expression AtlasAT2G46830-
AtGenExpressAT2G46830-
ATTED-IIAT2G46830-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves, roots, stems, flowers and siliques. {ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a transcriptional repressor that performs overlapping functions with LHY in a regulatory feedback loop that is closely associated with the circadian oscillator of Arabidopsis. Binds to the evening element in the promoter of TOC1 and represses TOC1 transcription. CCA1 and LHY colocalize in the nucleus and form heterodimers in vivo. CCA1 and LHY function synergistically in regulating circadian rhythms of Arabidopsis.
UniProtTranscription factor involved in the circadian clock and in the phytochrome regulation. Binds to the promoter regions of APRR1/TOC1 and TCP21/CHE to repress their transcription. Binds to the promoter regions of CAB2A and CAB2B to promote their transcription. Represses both LHY and itself. {ECO:0000269|PubMed:11486091, ECO:0000269|PubMed:12007421, ECO:0000269|PubMed:12015970, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:19339503, ECO:0000269|PubMed:9657153}.
Function -- GeneRIF ? help Back to Top
  1. This study demonstrated a light-entrained circadian clock regulates ethylene release from unstressed, wild-type Arabidopsis (Arabidopsis thaliana) seedlings, with a peak in the mid-subjective day.
    [PMID: 15516515]
  2. A functional interaction between the CCA1 clock component and one of the PRR family members, PRR5, by employing transgenic lines overexpressing both the CCA1 and PRR5 genes is reported.
    [PMID: 15725674]
  3. The function of ELF3 and ELF4 in their light-regulated expression associated with CCA1, LHY, and TOC1 as part of the central oscillator of the circadian clock in Arabidopsis is reported.
    [PMID: 16212608]
  4. TOC1 regulates the floral transition in a CCA1/LHY-dependent manner while CCA1/LHY functions upstream of TOC1 in regulating a photomorphogenic process.
    [PMID: 17483414]
  5. The linkages of TOC1, CCA1 and LHY genes and the canonical CO-FT flowering pathway were studied.
    [PMID: 17540692]
  6. This study suggests that the combination of light regulation of CCA1 transcription and CCA1 messenger RNA degradation is important for ensuring that the Arabidopsis circadian oscillator is accurately entrained by environmental changes.
    [PMID: 17873091]
  7. Regulation of CCA1 by organic N signals may represent a novel input mechanism for N-nutrients to affect plant circadian clock function.
    [PMID: 18344319]
  8. data suggests that CCA1 acts predominantly as a transcriptional repressor in nature
    [PMID: 18460819]
  9. CCA1 and LHY delay flowering time under continuous light by reducing the accumulation of SVP.
    [PMID: 19011118]
  10. CCA1 and LHY function synergistically in regulating circadian rhythms of Arabidopsis.
    [PMID: 19218364]
  11. CCA1 is localized to the nucleus in vivo and that there is no significant delay between the translation of CCA1 and its translocation to the nucleus.
    [PMID: 19339503]
  12. LHY/CCA1 regulates a pathway negatively controlling flowering locus T (FT), possibly via ELF3-SVP/FLC.
    [PMID: 19383102]
  13. Expression of CCA1 is regulated in part by a regulatory element within the 5'UTR.
    [PMID: 20119844]
  14. This study establishes a new model demonstrating that two opposing and temperature-dependent activities (CCA1-CK2) are essential for clock temperature compensation in Arabidopsis.
    [PMID: 21079791]
  15. Results reveal a role of PRR7 and PRR9 in regulating CCA1 and LHY activities in response to ambient temperature.
    [PMID: 21098730]
  16. role in circadian oscillatory regulation of chloroplastic thioredoxins f and m
    [PMID: 21196476]
  17. defence genes are under circadian control by CCA1, allowing plants to 'anticipate' infection at dawn when the pathogen normally disperses the spores and time immune responses according to the perception of different pathogenic signals upon infection
    [PMID: 21293378]
  18. CCA1 interacts with the BOA promoter and regulates its expression.
    [PMID: 21447790]
  19. CCA1/LHY-mediated output from the circadian clock contributes to plant cold tolerance through regulation of the CBF cold-response pathway.
    [PMID: 21471455]
  20. Functional interactions between the clock proteins LHY and CCA1 and the photoreceptor PhyB control organ elongation and flowering time.
    [PMID: 21822060]
  21. Interaction of Arabidopsis DET1 with CCA1 in mediating transcriptional repression in the plant circadian clock.
    [PMID: 21884973]
  22. show that CCA1 represses ELF3 by associating with its promoter, completing a CCA1-ELF3 negative feedback loop that places ELF3 within the oscillator
    [PMID: 22190341]
  23. Our computational analysis suggests that TOC1 is a repressor of the morning genes Late Elongated Hypocotyl and Circadian Clock Associated1 rather than an activator as first conceived.
    [PMID: 22395476]
  24. dynamic self-regulation of CCA1 underlies the circadian clock regulation of temperature responses in Arabidopsis
    [PMID: 22715042]
  25. Rhythmic expression of CCA1 under light-dark cycling conditions correlates with histone modification.
    [PMID: 22878891]
  26. CCA1 activity is self-regulated by a splice variant CCA1beta and the CCA1beta production is modulated by low temperatures, linking the circadian clock with cold acclimation.
    [PMID: 22899064]
  27. We propose CCA1 as a master regulator of Reactive-Oxygen-Species homeostasis through association with the Evening Element in promoters of ROS genes in vivo to coordinate time-dependent responses to oxidative stress.
    [PMID: 23027948]
  28. Histone 3 activating marks associated with the translational start sites of CCA1/LHY and TOC1 are circadian regulated.
    [PMID: 23128602]
  29. the promoter activity of A. thaliana core clock genes CCA1 and PRR5 in heterologous L. japonicus cells
    [PMID: 23221703]
  30. Transcriptional co-regulators PRR9, PRR7 and PRR5 inhibit circadian clock morning loop CCA1 expression by binding to its promoter.
    [PMID: 24267177]
  31. work revealed several CCA1 targets that do not cycle in either LL or LD conditions. Together, our results emphasize an expanded role for the clock in regulating a diverse category of genes and key pathways in Arabidopsis
    [PMID: 26261339]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00103PBM26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G46830.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with peak levels occurring around 1 hour after dawn. Up-regulated by APRR1/TOC1 and transiently by light treatment. Down-regulated by APRR5, APRR7 and APRR9. The CCA1 mRNA is relatively stable in the dark and in far-red light but has a short half-life in red and blue light. {ECO:0000269|PubMed:17873091, ECO:0000269|PubMed:19095940, ECO:0000269|PubMed:19218364, ECO:0000269|PubMed:19286557, ECO:0000269|PubMed:20233950, ECO:0000269|PubMed:9144958, ECO:0000269|PubMed:9657153}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G09530 (A), AT3G46640 (A), AT5G37260 (R), AT5G59570 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G01060(R), AT1G04400(A), AT1G22770(R), AT1G29930(A), AT1G32900(A), AT1G65480(A), AT2G21660(R), AT2G40080(R), AT2G43010(A), AT2G46790(A), AT3G17820(A), AT3G46640(R), AT3G47340(R), AT3G59060(A), AT5G02810(A), AT5G15840(R), AT5G18170(R), AT5G49450(R), AT5G52310(R), AT5G57360(R), AT5G61380(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, Gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G46830, AT3G22170, AT4G18390, AT5G11260, AT1G01060
IntActSearch P92973
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Altered phytochrome regulation and shorter circadian oscillations. {ECO:0000269|PubMed:10097183, ECO:0000269|PubMed:19218364}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G46830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195110.0AY519511.1 Arabidopsis thaliana MYB transcription factor (At2g46830) mRNA, complete cds.
GenBankATU284220.0U28422.1 Arabidopsis thaliana DNA-binding protein CCA1 (CCA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850460.10.0protein CCA1
SwissprotP929730.0CCA1_ARATH; Protein CCA1
TrEMBLA0A0N7DST10.0A0A0N7DST1_ARALP; CCA1 protein
STRINGAT2G46830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9903510
MalvidsOGEM152671518
Publications ? help Back to Top
  1. Staiger D,Heintzen C
    The circadian system of Arabidopsis thaliana: forward and reverse genetic approaches.
    Chronobiol. Int., 1999. 16(1): p. 1-16
    [PMID:10023572]
  2. Green RM,Tobin EM
    Loss of the circadian clock-associated protein 1 in Arabidopsis results in altered clock-regulated gene expression.
    Proc. Natl. Acad. Sci. U.S.A., 1999. 96(7): p. 4176-9
    [PMID:10097183]
  3. Fowler S, et al.
    GIGANTEA: a circadian clock-controlled gene that regulates photoperiodic flowering in Arabidopsis and encodes a protein with several possible membrane-spanning domains.
    EMBO J., 1999. 18(17): p. 4679-88
    [PMID:10469647]
  4. Park DH, et al.
    Control of circadian rhythms and photoperiodic flowering by the Arabidopsis GIGANTEA gene.
    Science, 1999. 285(5433): p. 1579-82
    [PMID:10477524]
  5. Somers DE
    The physiology and molecular bases of the plant circadian clock.
    Plant Physiol., 1999. 121(1): p. 9-20
    [PMID:10482655]
  6. Sugano S,Andronis C,Ong MS,Green RM,Tobin EM
    The protein kinase CK2 is involved in regulation of circadian rhythms in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 1999. 96(22): p. 12362-6
    [PMID:10535927]
  7. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  8. Schaffer R, et al.
    Microarray analysis of diurnal and circadian-regulated genes in Arabidopsis.
    Plant Cell, 2001. 13(1): p. 113-23
    [PMID:11158533]
  9. Xu Y,Johnson CH
    A clock- and light-regulated gene that links the circadian oscillator to LHCB gene expression.
    Plant Cell, 2001. 13(6): p. 1411-25
    [PMID:11402169]
  10. Alabadí D, et al.
    Reciprocal regulation between TOC1 and LHY/CCA1 within the Arabidopsis circadian clock.
    Science, 2001. 293(5531): p. 880-3
    [PMID:11486091]
  11. Makino S,Matsushika A,Kojima M,Yamashino T,Mizuno T
    The APRR1/TOC1 quintet implicated in circadian rhythms of Arabidopsis thaliana: I. Characterization with APRR1-overexpressing plants.
    Plant Cell Physiol., 2002. 43(1): p. 58-69
    [PMID:11828023]
  12. Alabad
    Critical role for CCA1 and LHY in maintaining circadian rhythmicity in Arabidopsis.
    Curr. Biol., 2002. 12(9): p. 757-61
    [PMID:12007421]
  13. Mizoguchi T, et al.
    LHY and CCA1 are partially redundant genes required to maintain circadian rhythms in Arabidopsis.
    Dev. Cell, 2002. 2(5): p. 629-41
    [PMID:12015970]
  14. Yoshida I,Yamagata H,Hirasawa E
    Signal transduction controlling the blue- and red-light mediated gene expression of S-adenosylmethionine decarboxylase in Pharbitis nil.
    J. Exp. Bot., 2002. 53(373): p. 1525-9
    [PMID:12021301]
  15. Green RM,Tingay S,Wang ZY,Tobin EM
    Circadian rhythms confer a higher level of fitness to Arabidopsis plants.
    Plant Physiol., 2002. 129(2): p. 576-84
    [PMID:12068102]
  16. Devlin PF
    Signs of the time: environmental input to the circadian clock.
    J. Exp. Bot., 2002. 53(374): p. 1535-50
    [PMID:12096092]
  17. Carr
    MYB transcription factors in the Arabidopsis circadian clock.
    J. Exp. Bot., 2002. 53(374): p. 1551-7
    [PMID:12096093]
  18. Kircher S, et al.
    Nucleocytoplasmic partitioning of the plant photoreceptors phytochrome A, B, C, D, and E is regulated differentially by light and exhibits a diurnal rhythm.
    Plant Cell, 2002. 14(7): p. 1541-55
    [PMID:12119373]
  19. Matsushika A,Imamura A,Yamashino T,Mizuno T
    Aberrant expression of the light-inducible and circadian-regulated APRR9 gene belonging to the circadian-associated APRR1/TOC1 quintet results in the phenotype of early flowering in Arabidopsis thaliana.
    Plant Cell Physiol., 2002. 43(8): p. 833-43
    [PMID:12198185]
  20. Doyle MR, et al.
    The ELF4 gene controls circadian rhythms and flowering time in Arabidopsis thaliana.
    Nature, 2002. 419(6902): p. 74-7
    [PMID:12214234]
  21. Michael TP,McClung CR
    Phase-specific circadian clock regulatory elements in Arabidopsis.
    Plant Physiol., 2002. 130(2): p. 627-38
    [PMID:12376630]
  22. Hall A,Kozma-Bogn
    Distinct regulation of CAB and PHYB gene expression by similar circadian clocks.
    Plant J., 2002. 32(4): p. 529-37
    [PMID:12445124]
  23. Sato E,Nakamichi N,Yamashino T,Mizuno T
    Aberrant expression of the Arabidopsis circadian-regulated APRR5 gene belonging to the APRR1/TOC1 quintet results in early flowering and hypersensitiveness to light in early photomorphogenesis.
    Plant Cell Physiol., 2002. 43(11): p. 1374-85
    [PMID:12461138]
  24. M
    Dual role of TOC1 in the control of circadian and photomorphogenic responses in Arabidopsis.
    Plant Cell, 2003. 15(1): p. 223-36
    [PMID:12509533]
  25. Staiger D, et al.
    The Arabidopsis SRR1 gene mediates phyB signaling and is required for normal circadian clock function.
    Genes Dev., 2003. 17(2): p. 256-68
    [PMID:12533513]
  26. Kim JY,Song HR,Taylor BL,Carr
    Light-regulated translation mediates gated induction of the Arabidopsis clock protein LHY.
    EMBO J., 2003. 22(4): p. 935-44
    [PMID:12574129]
  27. Nakamichi N,Matsushika A,Yamashino T,Mizuno T
    Cell autonomous circadian waves of the APRR1/TOC1 quintet in an established cell line of Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(3): p. 360-5
    [PMID:12668783]
  28. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  29. Tenorio G,Orea A,Romero JM,M
    Oscillation of mRNA level and activity of granule-bound starch synthase I in Arabidopsis leaves during the day/night cycle.
    Plant Mol. Biol., 2003. 51(6): p. 949-58
    [PMID:12777053]
  30. Michael TP,McClung CR
    Enhancer trapping reveals widespread circadian clock transcriptional control in Arabidopsis.
    Plant Physiol., 2003. 132(2): p. 629-39
    [PMID:12805593]
  31. Eriksson ME,Millar AJ
    The circadian clock. A plant's best friend in a spinning world.
    Plant Physiol., 2003. 132(2): p. 732-8
    [PMID:12805602]
  32. Eriksson ME,Hanano S,Southern MM,Hall A,Millar AJ
    Response regulator homologues have complementary, light-dependent functions in the Arabidopsis circadian clock.
    Planta, 2003. 218(1): p. 159-62
    [PMID:12955513]
  33. Kuno N, et al.
    The novel MYB protein EARLY-PHYTOCHROME-RESPONSIVE1 is a component of a slave circadian oscillator in Arabidopsis.
    Plant Cell, 2003. 15(10): p. 2476-88
    [PMID:14523250]
  34. Hall A, et al.
    The TIME FOR COFFEE gene maintains the amplitude and timing of Arabidopsis circadian clocks.
    Plant Cell, 2003. 15(11): p. 2719-29
    [PMID:14555691]
  35. Maxwell BB,Andersson CR,Poole DS,Kay SA,Chory J
    HY5, Circadian Clock-Associated 1, and a cis-element, DET1 dark response element, mediate DET1 regulation of chlorophyll a/b-binding protein 2 expression.
    Plant Physiol., 2003. 133(4): p. 1565-77
    [PMID:14563928]
  36. Kaczorowski KA,Quail PH
    Arabidopsis PSEUDO-RESPONSE REGULATOR7 is a signaling intermediate in phytochrome-regulated seedling deetiolation and phasing of the circadian clock.
    Plant Cell, 2003. 15(11): p. 2654-65
    [PMID:14563930]
  37. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  38. Ito S, et al.
    Characterization of the APRR9 pseudo-response regulator belonging to the APRR1/TOC1 quintet in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(11): p. 1237-45
    [PMID:14634162]
  39. Oda A,Fujiwara S,Kamada H,Coupland G,Mizoguchi T
    Antisense suppression of the Arabidopsis PIF3 gene does not affect circadian rhythms but causes early flowering and increases FT expression.
    FEBS Lett., 2004. 557(1-3): p. 259-64
    [PMID:14741378]
  40. Nakamichi N, et al.
    Characterization of plant circadian rhythms by employing Arabidopsis cultured cells with bioluminescence reporters.
    Plant Cell Physiol., 2004. 45(1): p. 57-67
    [PMID:14749486]
  41. Daniel X,Sugano S,Tobin EM
    CK2 phosphorylation of CCA1 is necessary for its circadian oscillator function in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(9): p. 3292-7
    [PMID:14978263]
  42. Searle I,Coupland G
    Induction of flowering by seasonal changes in photoperiod.
    EMBO J., 2004. 23(6): p. 1217-22
    [PMID:15014450]
  43. Yasuhara M, et al.
    Identification of ASK and clock-associated proteins as molecular partners of LKP2 (LOV kelch protein 2) in Arabidopsis.
    J. Exp. Bot., 2004. 55(405): p. 2015-27
    [PMID:15310821]
  44. Thain SC, et al.
    Circadian rhythms of ethylene emission in Arabidopsis.
    Plant Physiol., 2004. 136(3): p. 3751-61
    [PMID:15516515]
  45. Farré EM,Harmer SL,Harmon FG,Yanovsky MJ,Kay SA
    Overlapping and distinct roles of PRR7 and PRR9 in the Arabidopsis circadian clock.
    Curr. Biol., 2005. 15(1): p. 47-54
    [PMID:15649364]
  46. Nakamichi N, et al.
    The Arabidopsis pseudo-response regulators, PRR5 and PRR7, coordinately play essential roles for circadian clock function.
    Plant Cell Physiol., 2005. 46(4): p. 609-19
    [PMID:15695441]
  47. Fujimori T,Sato E,Yamashino T,Mizuno T
    PRR5 (PSEUDO-RESPONSE REGULATOR 5) plays antagonistic roles to CCA1 (CIRCADIAN CLOCK-ASSOCIATED 1) in Arabidopsis thaliana.
    Biosci. Biotechnol. Biochem., 2005. 69(2): p. 426-30
    [PMID:15725674]
  48. Boxall SF, et al.
    Conservation and divergence of circadian clock operation in a stress-inducible Crassulacean acid metabolism species reveals clock compensation against stress.
    Plant Physiol., 2005. 137(3): p. 969-82
    [PMID:15734916]
  49. Chang WC,Li CW,Chen BS
    Quantitative inference of dynamic regulatory pathways via microarray data.
    BMC Bioinformatics, 2005. 6: p. 44
    [PMID:15748298]
  50. Nakamichi N,Kita M,Ito S,Yamashino T,Mizuno T
    PSEUDO-RESPONSE REGULATORS, PRR9, PRR7 and PRR5, together play essential roles close to the circadian clock of Arabidopsis thaliana.
    Plant Cell Physiol., 2005. 46(5): p. 686-98
    [PMID:15767265]
  51. Harmer SL,Kay SA
    Positive and negative factors confer phase-specific circadian regulation of transcription in Arabidopsis.
    Plant Cell, 2005. 17(7): p. 1926-40
    [PMID:15923346]
  52. Hazen SP, et al.
    LUX ARRHYTHMO encodes a Myb domain protein essential for circadian rhythms.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(29): p. 10387-92
    [PMID:16006522]
  53. Mizoguchi T, et al.
    Distinct roles of GIGANTEA in promoting flowering and regulating circadian rhythms in Arabidopsis.
    Plant Cell, 2005. 17(8): p. 2255-70
    [PMID:16006578]
  54. Lu Y,Gehan JP,Sharkey TD
    Daylength and circadian effects on starch degradation and maltose metabolism.
    Plant Physiol., 2005. 138(4): p. 2280-91
    [PMID:16055686]
  55. Onai K,Ishiura M
    PHYTOCLOCK 1 encoding a novel GARP protein essential for the Arabidopsis circadian clock.
    Genes Cells, 2005. 10(10): p. 963-72
    [PMID:16164597]
  56. Kikis EA,Khanna R,Quail PH
    ELF4 is a phytochrome-regulated component of a negative-feedback loop involving the central oscillator components CCA1 and LHY.
    Plant J., 2005. 44(2): p. 300-13
    [PMID:16212608]
  57. Salom
    Arabidopsis response regulators ARR3 and ARR4 play cytokinin-independent roles in the control of circadian period.
    Plant Cell, 2006. 18(1): p. 55-69
    [PMID:16326927]
  58. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  59. Miwa K,Serikawa M,Suzuki S,Kondo T,Oyama T
    Conserved expression profiles of circadian clock-related genes in two Lemna species showing long-day and short-day photoperiodic flowering responses.
    Plant Cell Physiol., 2006. 47(5): p. 601-12
    [PMID:16524874]
  60. McClung CR
    Plant circadian rhythms.
    Plant Cell, 2006. 18(4): p. 792-803
    [PMID:16595397]
  61. Gould PD, et al.
    The molecular basis of temperature compensation in the Arabidopsis circadian clock.
    Plant Cell, 2006. 18(5): p. 1177-87
    [PMID:16617099]
  62. Ishikawa M,Kiba T,Chua NH
    The Arabidopsis SPA1 gene is required for circadian clock function and photoperiodic flowering.
    Plant J., 2006. 46(5): p. 736-46
    [PMID:16709190]
  63. Chen M,Ni M
    RFI2, a RING-domain zinc finger protein, negatively regulates CONSTANS expression and photoperiodic flowering.
    Plant J., 2006. 46(5): p. 823-33
    [PMID:16709197]
  64. Locke JC, et al.
    Extension of a genetic network model by iterative experimentation and mathematical analysis.
    Mol. Syst. Biol., 2005. 1: p. 2005.0013
    [PMID:16729048]
  65. Forger D,Drapeau M,Collins B,Blau J
    A new model for circadian clock research?
    Mol. Syst. Biol., 2005. 1: p. 2005.0014
    [PMID:16729049]
  66. Locke JC, et al.
    Experimental validation of a predicted feedback loop in the multi-oscillator clock of Arabidopsis thaliana.
    Mol. Syst. Biol., 2006. 2: p. 59
    [PMID:17102804]
  67. Murakami M,Tago Y,Yamashino T,Mizuno T
    Comparative overviews of clock-associated genes of Arabidopsis thaliana and Oryza sativa.
    Plant Cell Physiol., 2007. 48(1): p. 110-21
    [PMID:17132630]
  68. Dodd AN, et al.
    Time of day modulates low-temperature Ca signals in Arabidopsis.
    Plant J., 2006. 48(6): p. 962-73
    [PMID:17227550]
  69. Yakir E,Hilman D,Harir Y,Green RM
    Regulation of output from the plant circadian clock.
    FEBS J., 2007. 274(2): p. 335-45
    [PMID:17229141]
  70. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  71. McWatters HG, et al.
    ELF4 is required for oscillatory properties of the circadian clock.
    Plant Physiol., 2007. 144(1): p. 391-401
    [PMID:17384164]
  72. Hecht V, et al.
    Pea LATE BLOOMER1 is a GIGANTEA ortholog with roles in photoperiodic flowering, deetiolation, and transcriptional regulation of circadian clock gene homologs.
    Plant Physiol., 2007. 144(2): p. 648-61
    [PMID:17468223]
  73. Ding Z,Doyle MR,Amasino RM,Davis SJ
    A complex genetic interaction between Arabidopsis thaliana TOC1 and CCA1/LHY in driving the circadian clock and in output regulation.
    Genetics, 2007. 176(3): p. 1501-10
    [PMID:17483414]
  74. Ding Z,Millar AJ,Davis AM,Davis SJ
    TIME FOR COFFEE encodes a nuclear regulator in the Arabidopsis thaliana circadian clock.
    Plant Cell, 2007. 19(5): p. 1522-36
    [PMID:17496120]
  75. Nakamichi N, et al.
    Arabidopsis clock-associated pseudo-response regulators PRR9, PRR7 and PRR5 coordinately and positively regulate flowering time through the canonical CONSTANS-dependent photoperiodic pathway.
    Plant Cell Physiol., 2007. 48(6): p. 822-32
    [PMID:17504813]
  76. Ito S, et al.
    Genetic linkages between circadian clock-associated components and phytochrome-dependent red light signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2007. 48(7): p. 971-83
    [PMID:17519251]
  77. Xu X,Gookin T,Jiang CZ,Reid M
    Genes associated with opening and senescence of Mirabilis jalapa flowers.
    J. Exp. Bot., 2007. 58(8): p. 2193-201
    [PMID:17525082]
  78. Niwa Y, et al.
    Genetic linkages of the circadian clock-associated genes, TOC1, CCA1 and LHY, in the photoperiodic control of flowering time in Arabidopsis thaliana.
    Plant Cell Physiol., 2007. 48(7): p. 925-37
    [PMID:17540692]
  79. Zhang X, et al.
    Constitutive expression of CIR1 (RVE2) affects several circadian-regulated processes and seed germination in Arabidopsis.
    Plant J., 2007. 51(3): p. 512-25
    [PMID:17587236]
  80. Perales M,M
    A functional link between rhythmic changes in chromatin structure and the Arabidopsis biological clock.
    Plant Cell, 2007. 19(7): p. 2111-23
    [PMID:17616736]
  81. Hassidim M, et al.
    Mutations in CHLOROPLAST RNA BINDING provide evidence for the involvement of the chloroplast in the regulation of the circadian clock in Arabidopsis.
    Plant J., 2007. 51(4): p. 551-62
    [PMID:17617174]
  82. Slotte T,Holm K,McIntyre LM,Lagercrantz U,Lascoux M
    Differential expression of genes important for adaptation in Capsella bursa-pastoris (Brassicaceae).
    Plant Physiol., 2007. 145(1): p. 160-73
    [PMID:17631524]
  83. Portol
    Altered oscillator function affects clock resonance and is responsible for the reduced day-length sensitivity of CKB4 overexpressing plants.
    Plant J., 2007. 51(6): p. 966-77
    [PMID:17662034]
  84. Kevei E, et al.
    Arabidopsis thaliana circadian clock is regulated by the small GTPase LIP1.
    Curr. Biol., 2007. 17(17): p. 1456-64
    [PMID:17683937]
  85. Yakir E,Hilman D,Hassidim M,Green RM
    CIRCADIAN CLOCK ASSOCIATED1 transcript stability and the entrainment of the circadian clock in Arabidopsis.
    Plant Physiol., 2007. 145(3): p. 925-32
    [PMID:17873091]
  86. Farr
    PRR7 protein levels are regulated by light and the circadian clock in Arabidopsis.
    Plant J., 2007. 52(3): p. 548-60
    [PMID:17877705]
  87. Kang X,Zhou Y,Sun X,Ni M
    HYPERSENSITIVE TO RED AND BLUE 1 and its C-terminal regulatory function control FLOWERING LOCUS T expression.
    Plant J., 2007. 52(5): p. 937-48
    [PMID:17916114]
  88. Ito S, et al.
    Insight into missing genetic links between two evening-expressed pseudo-response regulator genes TOC1 and PRR5 in the circadian clock-controlled circuitry in Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(2): p. 201-13
    [PMID:18178585]
  89. Kant P, et al.
    Functional-genomics-based identification of genes that regulate Arabidopsis responses to multiple abiotic stresses.
    Plant Cell Environ., 2008. 31(6): p. 697-714
    [PMID:18182014]
  90. Abe M,Fujiwara M,Kurotani K,Yokoi S,Shimamoto K
    Identification of dynamin as an interactor of rice GIGANTEA by tandem affinity purification (TAP).
    Plant Cell Physiol., 2008. 49(3): p. 420-32
    [PMID:18296724]
  91. Gutiérrez RA, et al.
    Systems approach identifies an organic nitrogen-responsive gene network that is regulated by the master clock control gene CCA1.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(12): p. 4939-44
    [PMID:18344319]
  92. Bieniawska Z, et al.
    Disruption of the Arabidopsis circadian clock is responsible for extensive variation in the cold-responsive transcriptome.
    Plant Physiol., 2008. 147(1): p. 263-79
    [PMID:18375597]
  93. Kawamura M,Ito S,Nakamichi N,Yamashino T,Mizuno T
    The function of the clock-associated transcriptional regulator CCA1 (CIRCADIAN CLOCK-ASSOCIATED 1) in Arabidopsis thaliana.
    Biosci. Biotechnol. Biochem., 2008. 72(5): p. 1307-16
    [PMID:18460819]
  94. Salom
    Circadian timekeeping during early Arabidopsis development.
    Plant Physiol., 2008. 147(3): p. 1110-25
    [PMID:18480377]
  95. Knight H,Thomson AJ,McWatters HG
    Sensitive to freezing6 integrates cellular and environmental inputs to the plant circadian clock.
    Plant Physiol., 2008. 148(1): p. 293-303
    [PMID:18614706]
  96. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  97. Wu JF,Wang Y,Wu SH
    Two new clock proteins, LWD1 and LWD2, regulate Arabidopsis photoperiodic flowering.
    Plant Physiol., 2008. 148(2): p. 948-59
    [PMID:18676661]
  98. Liu H, et al.
    Analysis of clock gene homologs using unifoliolates as target organs in soybean (Glycine max).
    J. Plant Physiol., 2009. 166(3): p. 278-89
    [PMID:18707796]
  99. Fujiwara S, et al.
    Circadian clock proteins LHY and CCA1 regulate SVP protein accumulation to control flowering in Arabidopsis.
    Plant Cell, 2008. 20(11): p. 2960-71
    [PMID:19011118]
  100. Ni Z, et al.
    Altered circadian rhythms regulate growth vigour in hybrids and allopolyploids.
    Nature, 2009. 457(7227): p. 327-31
    [PMID:19029881]
  101. Knowles SM,Lu SX,Tobin EM
    Testing time: can ethanol-induced pulses of proposed oscillator components phase shift rhythms in Arabidopsis?
    J. Biol. Rhythms, 2008. 23(6): p. 463-71
    [PMID:19060255]
  102. James AB, et al.
    The circadian clock in Arabidopsis roots is a simplified slave version of the clock in shoots.
    Science, 2008. 322(5909): p. 1832-5
    [PMID:19095940]
  103. Ito S, et al.
    A genetic study of the Arabidopsis circadian clock with reference to the TIMING OF CAB EXPRESSION 1 (TOC1) gene.
    Plant Cell Physiol., 2009. 50(2): p. 290-303
    [PMID:19098071]
  104. Takata N, et al.
    Molecular phylogeny and expression of poplar circadian clock genes, LHY1 and LHY2.
    New Phytol., 2009. 181(4): p. 808-19
    [PMID:19140936]
  105. Strasser B,Alvarez MJ,Califano A,Cerd
    A complementary role for ELF3 and TFL1 in the regulation of flowering time by ambient temperature.
    Plant J., 2009. 58(4): p. 629-40
    [PMID:19187043]
  106. Lu SX,Knowles SM,Andronis C,Ong MS,Tobin EM
    CIRCADIAN CLOCK ASSOCIATED1 and LATE ELONGATED HYPOCOTYL function synergistically in the circadian clock of Arabidopsis.
    Plant Physiol., 2009. 150(2): p. 834-43
    [PMID:19218364]
  107. Pruneda-Paz JL,Breton G,Para A,Kay SA
    A functional genomics approach reveals CHE as a component of the Arabidopsis circadian clock.
    Science, 2009. 323(5920): p. 1481-5
    [PMID:19286557]
  108. Proels RK,Roitsch T
    Extracellular invertase LIN6 of tomato: a pivotal enzyme for integration of metabolic, hormonal, and stress signals is regulated by a diurnal rhythm.
    J. Exp. Bot., 2009. 60(6): p. 1555-67
    [PMID:19297549]
  109. Yakir E, et al.
    Posttranslational regulation of CIRCADIAN CLOCK ASSOCIATED1 in the circadian oscillator of Arabidopsis.
    Plant Physiol., 2009. 150(2): p. 844-57
    [PMID:19339503]
  110. Fukushima A, et al.
    Impact of clock-associated Arabidopsis pseudo-response regulators in metabolic coordination.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(17): p. 7251-6
    [PMID:19359492]
  111. Robertson FC,Webb AA
    Revolutionary functional genomics liberates CHE.
    Nat. Chem. Biol., 2009. 5(5): p. 276-7
    [PMID:19377451]
  112. Stephenson PG,Fankhauser C,Terry MJ
    PIF3 is a repressor of chloroplast development.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(18): p. 7654-9
    [PMID:19380736]
  113. Yoshida R, et al.
    Possible role of early flowering 3 (ELF3) in clock-dependent floral regulation by short vegetative phase (SVP) in Arabidopsis thaliana.
    New Phytol., 2009. 182(4): p. 838-50
    [PMID:19383102]
  114. Penfield S,Hall A
    A role for multiple circadian clock genes in the response to signals that break seed dormancy in Arabidopsis.
    Plant Cell, 2009. 21(6): p. 1722-32
    [PMID:19542296]
  115. Okada R, et al.
    Functional characterization of CCA1/LHY homolog genes, PpCCA1a and PpCCA1b, in the moss Physcomitrella patens.
    Plant J., 2009. 60(3): p. 551-63
    [PMID:19624471]
  116. Ishida K,Niwa Y,Yamashino T,Mizuno T
    A genome-wide compilation of the two-component systems in Lotus japonicus.
    DNA Res., 2009. 16(4): p. 237-47
    [PMID:19675111]
  117. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  118. Nakamichi N, et al.
    Linkage between circadian clock and tricarboxylic acid cycle in Arabidopsis.
    Plant Signal Behav, 2009. 4(7): p. 660-2
    [PMID:19820331]
  119. Hotta CT, et al.
    Are there multiple circadian clocks in plants?
    Plant Signal Behav, 2008. 3(5): p. 342-4
    [PMID:19841666]
  120. Ogiso E,Takahashi Y,Sasaki T,Yano M,Izawa T
    The role of casein kinase II in flowering time regulation has diversified during evolution.
    Plant Physiol., 2010. 152(2): p. 808-20
    [PMID:20007447]
  121. Andronis C,Barak S,Knowles SM,Sugano S,Tobin EM
    The clock protein CCA1 and the bZIP transcription factor HY5 physically interact to regulate gene expression in Arabidopsis.
    Mol Plant, 2008. 1(1): p. 58-67
    [PMID:20031914]
  122. Ovadia A,Tabibian-Keissar H,Cohen Y,Kenigsbuch D
    The 5'UTR of CCA1 includes an autoregulatory cis element that segregates between light and circadian regulation of CCA1 and LHY.
    Plant Mol. Biol., 2010. 72(6): p. 659-71
    [PMID:20119844]
  123. Okada R,Satbhai SB,Aoki S
    Photoperiod-dependent regulation of cell growth by PpCCA1a and PpCCA1b genes encoding single-myb clock proteins in the moss Physcomitrella patens.
    Genes Genet. Syst., 2009. 84(5): p. 379-84
    [PMID:20154425]
  124. Nakamichi N, et al.
    PSEUDO-RESPONSE REGULATORS 9, 7, and 5 are transcriptional repressors in the Arabidopsis circadian clock.
    Plant Cell, 2010. 22(3): p. 594-605
    [PMID:20233950]
  125. Andr
    Deregulated copper transport affects Arabidopsis development especially in the absence of environmental cycles.
    Plant Physiol., 2010. 153(1): p. 170-84
    [PMID:20335405]
  126. Baudry A, et al.
    F-box proteins FKF1 and LKP2 act in concert with ZEITLUPE to control Arabidopsis clock progression.
    Plant Cell, 2010. 22(3): p. 606-22
    [PMID:20354196]
  127. Takata N,Saito S,Saito CT,Uemura M
    Phylogenetic footprint of the plant clock system in angiosperms: evolutionary processes of pseudo-response regulators.
    BMC Evol. Biol., 2010. 10: p. 126
    [PMID:20433765]
  128. Graf A,Schlereth A,Stitt M,Smith AM
    Circadian control of carbohydrate availability for growth in Arabidopsis plants at night.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(20): p. 9458-63
    [PMID:20439704]
  129. Portol
    The functional interplay between protein kinase CK2 and CCA1 transcriptional activity is essential for clock temperature compensation in Arabidopsis.
    PLoS Genet., 2010. 6(11): p. e1001201
    [PMID:21079791]
  130. Salom
    The role of the Arabidopsis morning loop components CCA1, LHY, PRR7, and PRR9 in temperature compensation.
    Plant Cell, 2010. 22(11): p. 3650-61
    [PMID:21098730]
  131. Lu SX, et al.
    The Jumonji C domain-containing protein JMJ30 regulates period length in the Arabidopsis circadian clock.
    Plant Physiol., 2011. 155(2): p. 906-15
    [PMID:21139085]
  132. Giraud E, et al.
    TCP transcription factors link the regulation of genes encoding mitochondrial proteins with the circadian clock in Arabidopsis thaliana.
    Plant Cell, 2010. 22(12): p. 3921-34
    [PMID:21183706]
  133. Barajas-L
    Circadian regulation of chloroplastic f and m thioredoxins through control of the CCA1 transcription factor.
    J. Exp. Bot., 2011. 62(6): p. 2039-51
    [PMID:21196476]
  134. Morant PE, et al.
    A robust two-gene oscillator at the core of Ostreococcus tauri circadian clock.
    Chaos, 2010. 20(4): p. 045108
    [PMID:21198120]
  135. Farinas B,Mas P
    Functional implication of the MYB transcription factor RVE8/LCL5 in the circadian control of histone acetylation.
    Plant J., 2011. 66(2): p. 318-29
    [PMID:21205033]
  136. Troein C, et al.
    Multiple light inputs to a simple clock circuit allow complex biological rhythms.
    Plant J., 2011. 66(2): p. 375-85
    [PMID:21219507]
  137. Dixon LE, et al.
    Temporal repression of core circadian genes is mediated through EARLY FLOWERING 3 in Arabidopsis.
    Curr. Biol., 2011. 21(2): p. 120-5
    [PMID:21236675]
  138. Wang W, et al.
    Timing of plant immune responses by a central circadian regulator.
    Nature, 2011. 470(7332): p. 110-4
    [PMID:21293378]
  139. Nefissi R, et al.
    Double loss-of-function mutation in EARLY FLOWERING 3 and CRYPTOCHROME 2 genes delays flowering under continuous light but accelerates it under long days and short days: an important role for Arabidopsis CRY2 to accelerate flowering time in continuous light.
    J. Exp. Bot., 2011. 62(8): p. 2731-44
    [PMID:21296763]
  140. Yoo SK,Hong SM,Lee JS,Ahn JH
    A genetic screen for leaf movement mutants identifies a potential role for AGAMOUS-LIKE 6 (AGL6) in circadian-clock control.
    Mol. Cells, 2011. 31(3): p. 281-7
    [PMID:21331777]
  141. Dai S, et al.
    BROTHER OF LUX ARRHYTHMO is a component of the Arabidopsis circadian clock.
    Plant Cell, 2011. 23(3): p. 961-72
    [PMID:21447790]
  142. O'Neill JS,van Ooijen G,Le Bihan T,Millar AJ
    Circadian clock parameter measurement: characterization of clock transcription factors using surface plasmon resonance.
    J. Biol. Rhythms, 2011. 26(2): p. 91-8
    [PMID:21454289]
  143. Dong MA,Farr
    Circadian clock-associated 1 and late elongated hypocotyl regulate expression of the C-repeat binding factor (CBF) pathway in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(17): p. 7241-6
    [PMID:21471455]
  144. Farinas B,Mas P
    Histone acetylation and the circadian clock: a role for the MYB transcription factor RVE8/LCL5.
    Plant Signal Behav, 2011. 6(4): p. 541-3
    [PMID:21474993]
  145. Rawat R, et al.
    REVEILLE8 and PSEUDO-REPONSE REGULATOR5 form a negative feedback loop within the Arabidopsis circadian clock.
    PLoS Genet., 2011. 7(3): p. e1001350
    [PMID:21483796]
  146. Li G, et al.
    Coordinated transcriptional regulation underlying the circadian clock in Arabidopsis.
    Nat. Cell Biol., 2011. 13(5): p. 616-22
    [PMID:21499259]
  147. Yakir E, et al.
    Cell autonomous and cell-type specific circadian rhythms in Arabidopsis.
    Plant J., 2011. 68(3): p. 520-31
    [PMID:21781194]
  148. Miyata K,Calvi
    Suppression of late-flowering and semi-dwarf phenotypes in the Arabidopsis clock mutant lhy-12;cca1-101 by phyB under continuous light.
    Plant Signal Behav, 2011. 6(8): p. 1162-71
    [PMID:21822060]
  149. McClung CR
    The photomorphogenic protein, DE-ETIOLATED 1, is a critical transcriptional corepressor in the central loop of the Arabidopsis circadian clock.
    Mol. Cell, 2011. 43(5): p. 693-4
    [PMID:21884969]
  150. Lau OS, et al.
    Interaction of Arabidopsis DET1 with CCA1 and LHY in mediating transcriptional repression in the plant circadian clock.
    Mol. Cell, 2011. 43(5): p. 703-12
    [PMID:21884973]
  151. Lu SX, et al.
    A role for protein kinase casein kinase2 α-subunits in the Arabidopsis circadian clock.
    Plant Physiol., 2011. 157(3): p. 1537-45
    [PMID:21900482]
  152. Lu SX, et al.
    CCA1 and ELF3 Interact in the control of hypocotyl length and flowering time in Arabidopsis.
    Plant Physiol., 2012. 158(2): p. 1079-88
    [PMID:22190341]
  153. Sellaro R,Pac
    Diurnal dependence of growth responses to shade in Arabidopsis: role of hormone, clock, and light signaling.
    Mol Plant, 2012. 5(3): p. 619-28
    [PMID:22311777]
  154. Gendron JM, et al.
    Arabidopsis circadian clock protein, TOC1, is a DNA-binding transcription factor.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(8): p. 3167-72
    [PMID:22315425]
  155. Mulekar JJ,Huq E
    Does CK2 affect flowering time by modulating the autonomous pathway in Arabidopsis?
    Plant Signal Behav, 2012. 7(2): p. 292-4
    [PMID:22353866]
  156. Pokhilko A, et al.
    The clock gene circuit in Arabidopsis includes a repressilator with additional feedback loops.
    Mol. Syst. Biol., 2012. 8: p. 574
    [PMID:22395476]
  157. Seo PJ, et al.
    A self-regulatory circuit of CIRCADIAN CLOCK-ASSOCIATED1 underlies the circadian clock regulation of temperature responses in Arabidopsis.
    Plant Cell, 2012. 24(6): p. 2427-42
    [PMID:22715042]
  158. Song HR,Noh YS
    Rhythmic oscillation of histone acetylation and methylation at the Arabidopsis central clock loci.
    Mol. Cells, 2012. 34(3): p. 279-87
    [PMID:22878891]
  159. Park MJ,Seo PJ,Park CM
    CCA1 alternative splicing as a way of linking the circadian clock to temperature response in Arabidopsis.
    Plant Signal Behav, 2012. 7(9): p. 1194-6
    [PMID:22899064]
  160. Lai AG, et al.
    CIRCADIAN CLOCK-ASSOCIATED 1 regulates ROS homeostasis and oxidative stress responses.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(42): p. 17129-34
    [PMID:23027948]
  161. Kim MY,Shin JH,Kang YJ,Shim SR,Lee SH
    Divergence of flowering genes in soybean.
    J. Biosci., 2012. 37(5): p. 857-70
    [PMID:23107921]
  162. Hemmes H,Henriques R,Jang IC,Kim S,Chua NH
    Circadian clock regulates dynamic chromatin modifications associated with Arabidopsis CCA1/LHY and TOC1 transcriptional rhythms.
    Plant Cell Physiol., 2012. 53(12): p. 2016-29
    [PMID:23128602]
  163. Renault H, et al.
    γ-Aminobutyric acid transaminase deficiency impairs central carbon metabolism and leads to cell wall defects during salt stress in Arabidopsis roots.
    Plant Cell Environ., 2013. 36(5): p. 1009-18
    [PMID:23148892]
  164. Ueoka-Nakanishi H, et al.
    Molecular mechanisms of circadian rhythm in Lotus japonicus and Arabidopsis thaliana are sufficiently compatible to regulate heterologous core clock genes robustly.
    Biosci. Biotechnol. Biochem., 2012. 76(12): p. 2332-4
    [PMID:23221703]
  165. Schmal C,Reimann P,Staiger D
    A circadian clock-regulated toggle switch explains AtGRP7 and AtGRP8 oscillations in Arabidopsis thaliana.
    PLoS Comput. Biol., 2013. 9(3): p. e1002986
    [PMID:23555221]
  166. Karlgren A,Gyllenstrand N,K
    Conserved function of core clock proteins in the gymnosperm Norway spruce (Picea abies L. Karst).
    PLoS ONE, 2013. 8(3): p. e60110
    [PMID:23555899]
  167. Cui X, et al.
    Ubiquitin-specific proteases UBP12 and UBP13 act in circadian clock and photoperiodic flowering regulation in Arabidopsis.
    Plant Physiol., 2013. 162(2): p. 897-906
    [PMID:23645632]
  168. Zhang C, et al.
    Crosstalk between the circadian clock and innate immunity in Arabidopsis.
    PLoS Pathog., 2013. 9(6): p. e1003370
    [PMID:23754942]
  169. Kusakina J,Gould PD,Hall A
    A fast circadian clock at high temperatures is a conserved feature across Arabidopsis accessions and likely to be important for vegetative yield.
    Plant Cell Environ., 2014. 37(2): p. 327-40
    [PMID:23777196]
  170. Xie Q, et al.
    LNK1 and LNK2 are transcriptional coactivators in the Arabidopsis circadian oscillator.
    Plant Cell, 2014. 26(7): p. 2843-57
    [PMID:25012192]
  171. Lee HG,Lee K,Jang K,Seo PJ
    Circadian expression profiles of chromatin remodeling factor genes in Arabidopsis.
    J. Plant Res., 2015. 128(1): p. 187-99
    [PMID:25315904]
  172. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  173. Nagel DH, et al.
    Genome-wide identification of CCA1 targets uncovers an expanded clock network in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(34): p. E4802-10
    [PMID:26261339]
  174. Wang ZY, et al.
    A Myb-related transcription factor is involved in the phytochrome regulation of an Arabidopsis Lhcb gene.
    Plant Cell, 1997. 9(4): p. 491-507
    [PMID:9144958]
  175. Wang ZY,Tobin EM
    Constitutive expression of the CIRCADIAN CLOCK ASSOCIATED 1 (CCA1) gene disrupts circadian rhythms and suppresses its own expression.
    Cell, 1998. 93(7): p. 1207-17
    [PMID:9657153]
  176. Sugano S,Andronis C,Green RM,Wang ZY,Tobin EM
    Protein kinase CK2 interacts with and phosphorylates the Arabidopsis circadian clock-associated 1 protein.
    Proc. Natl. Acad. Sci. U.S.A., 1998. 95(18): p. 11020-5
    [PMID:9724822]