PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G46590.2
Common NameDAG2, DOF2.5, F13A10.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 369aa    MW: 40537.4 Da    PI: 9.1389
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G46590.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.4e-3976137263
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                  ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+sss
  AT2G46590.2  76 PQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSS 137
                  6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2675127IPR003851Zinc finger, Dof-type
PfamPF027016.2E-3378134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90180134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009416Biological Processresponse to light stimulus
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000034anatomyvascular system
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MDATKWTQGF QEMMNVKPME QIMIPNNNTH QPNTTSNARP NTILTSNGVS TAGATVSGVS  60
NNNNNTAVVA ERKARPQEKL NCPRCNSTNT KFCYYNNYSL TQPRYFCKGC RRYWTEGGSL  120
RNVPVGGSSR KNKRSSSSSS SNILQTIPSS LPDLNPPILF SNQIHNKSKG SSQDLNLLSF  180
PVMQDQHHHH VHMSQFLQMP KMEGNGNITH QQQPSSSSSV YGSSSSPVSA LELLRTGVNV  240
SSRSGINSSF MPSGSMMDSN TVLYTSSGFP TMVDYKPSNL SFSTDHQGLG HNSNNRSEAL  300
HSDHHQQGRV LFPFGDQMKE LSSSITQEVD HDDNQQQKSH GNNNNNNNSS PNNGYWSGMF  360
STTGGGSSW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.432210.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265448_at0.0
Expression AtlasAT2G46590-
AtGenExpressAT2G46590-
ATTED-IIAT2G46590-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos.
UniprotTISSUE SPECIFICITY: Expressed in the vascular system of the mother plant, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule.
Functional Description ? help Back to Top
Source Description
TAIRencodes a protein containing Dof zinc finger motifs. expression is limited to vascular system of the mother plant. recessive mutation is inherited as maternal-effect and expression is not detected in the embryo. mutants are defective in seed germination. mutants are more dependent on light and cold treatment and less sensitive to gibberellin during seed germination.
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the activation of a component that would trigger germination as a consequence of red light perception.
Function -- GeneRIF ? help Back to Top
  1. DAG2 is a positive regulator of the light-mediated seed germination process, and particularly reveal that this protein plays its main role downstream of PIL5 and DAG1 in the phytochrome B (phyB)-mediated pathway.
    [PMID: 25850831]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00319DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G46590.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G46590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2378110.0AJ237811.1 Arabidopsis thaliana mRNA for putative DNA binding protein (partial).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031549.10.0Dof-type zinc finger DNA-binding family protein
SwissprotQ9ZPY00.0DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A178VWF70.0A0A178VWF7_ARATH; DAG2
STRINGAT2G46590.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gualberti G, et al.
    Mutations in the Dof zinc finger genes DAG2 and DAG1 influence with opposite effects the germination of Arabidopsis seeds.
    Plant Cell, 2002. 14(6): p. 1253-63
    [PMID:12084825]
  3. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  4. Park DH, et al.
    The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling.
    Plant J., 2003. 34(2): p. 161-71
    [PMID:12694592]
  5. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  6. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  7. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  8. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  9. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  10. Yang X,Tuskan GA,Cheng MZ
    Divergence of the Dof gene families in poplar, Arabidopsis, and rice suggests multiple modes of gene evolution after duplication.
    Plant Physiol., 2006. 142(3): p. 820-30
    [PMID:16980566]
  11. Santopolo S, et al.
    DOF AFFECTING GERMINATION 2 is a positive regulator of light-mediated seed germination and is repressed by DOF AFFECTING GERMINATION 1.
    BMC Plant Biol., 2015. 15: p. 72
    [PMID:25850831]