PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G46130.1
Common NameATWRKY43, T3F17.22, WRKY43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 109aa    MW: 12951.8 Da    PI: 9.9919
Description WRKY DNA-binding protein 43
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G46130.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.7e-332987159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r ++++++ve+tYeg Hnh+
  AT2G46130.1 29 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKETSIVETTYEGIHNHP 87
                 59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-331487IPR003657WRKY domain
SuperFamilySSF1182901.44E-282188IPR003657WRKY domain
PROSITE profilePS5081127.7142489IPR003657WRKY domain
SMARTSM007743.4E-372988IPR003657WRKY domain
PfamPF031063.3E-263087IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MNGLVDSSRD KKMKNPRFSF RTKSDADILD DGYRWRKYGQ KSVKNSLYPR SYYRCTQHMC  60
NVKKQVQRLS KETSIVETTY EGIHNHPCEE LMQTLTPLLH QLQFLSKFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-251986774Probable WRKY transcription factor 4
2lex_A7e-251986774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266597_at1e-161
Expression AtlasAT2G46130-
AtGenExpressAT2G46130-
ATTED-IIAT2G46130-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00317DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G46130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8GY11
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G46130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1179310.0AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14.
GenBankBT0047010.0BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182136.22e-78WRKY DNA-binding protein 43
SwissprotQ8GY112e-79WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBLD7LDW55e-69D7LDW5_ARALL; WRKY DNA-binding protein 43
STRINGAT2G46130.19e-78(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  6. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  7. Ciolkowski I,Wanke D,Birkenbihl RP,Somssich IE
    Studies on DNA-binding selectivity of WRKY transcription factors lend structural clues into WRKY-domain function.
    Plant Mol. Biol., 2008. 68(1-2): p. 81-92
    [PMID:18523729]
  8. Geilen K,Heilmann M,Hillmer S,Böhmer M
    WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions.
    Sci Rep, 2017. 7(1): p. 14235
    [PMID:29079824]