PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G45880.1
Common NameBAM7, BMY4, F4I18.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 691aa    MW: 77131 Da    PI: 6.6347
Description beta-amylase 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G45880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822166.51.6e-51652151143
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr...kgskpl..eeaeaagssas..aspe 91 
                  ggs+r+++ +E+E++k+RER+RRai+a+i+ GLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++   +g+kp+  ++a aagssas  as++
  AT2G45880.1  65 GGSRRSRPLEEKERTKLRERHRRAITARILGGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPsksQGTKPTggSSAVAAGSSAShiASQQ 162
                  689******************************************************************9988999***9888888898888777888 PP

       DUF822  92 sslq.sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvl 143
                  +s   ++++ss l+spve +s+++k + +p+ps +d+++++s++ + +v + +
  AT2G45880.1 163 TSPPaLRVVSSGLRSPVELSSCRMKGVFTPAPSPYDMLPIQSPELVGSVNKAE 215
                  88777************************************995555554444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056879.7E-4266212IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514451.78E-174242690IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.4E-187245688IPR013781Glycoside hydrolase, catalytic domain
PfamPF013731.2E-96251671IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65282296IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65303321IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65325346IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060329337IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR007505.2E-65418440IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65491510IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65525541IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65542553IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65560583IPR001554Glycoside hydrolase, family 14
PRINTSPR007505.2E-65600622IPR001554Glycoside hydrolase, family 14
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MATDMHKLLG TSEEDDDEEM DMDVKEEDDG DRRNRDKHAA SGSSSNDEFM FQQSMQDQVG  60
TPGGGGSRRS RPLEEKERTK LRERHRRAIT ARILGGLRRH GNYNLRVRAD INDVIAALAR  120
EAGWVVLPDG TTFPSKSQGT KPTGGSSAVA AGSSASHIAS QQTSPPALRV VSSGLRSPVE  180
LSSCRMKGVF TPAPSPYDML PIQSPELVGS VNKAEGLVGC SVDVINSKQI LEIPPNLTEQ  240
DFSGTPYVPV YVMLPLGVIN MKCELADRDG LLKHLRILKS IHVDGVKVDC WWGIVEGHSP  300
QEYNWTGYRQ LFQMVRDLNL KIQVLMSFHE CGGNVGDDVC IPLPHWVAEI GRTNPDIYFT  360
DREGRRNPEC LSWGIDKERI LRGRTALEVY FDYMRSFRIE LAEFLEDGVI SMVEIGLGPC  420
GELRYPSCPI KHGWRYPGVG EFQCYDKYLS KSLRKAAESR GHLFWARGPD NTGSYNSQPQ  480
GTGFFCDGGD YDGLYGRFFL KWYSQVLIDH ADQILCLAKL VFDSSCIAAK LPDVHWWYRT  540
ASHAAELTAG FYNPSNRDGY SAIASTLKKH GATLSFVSGE VQVLNRPDDF SGALGEPEAV  600
AWQVLNAAWD SGTPVARENS LACHDRVGYN KMLESVKFRN DPDRKHLSSF AYSRLVPALM  660
EGHNIVEFER FVKKLHGEAV MNHHHHHHQQ V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wdq_A1e-13824767811444Beta-amylase
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.365790.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266914_at0.0
Expression AtlasAT2G45880-
AtGenExpressAT2G45880-
ATTED-IIAT2G45880-
Function -- GeneRIF ? help Back to Top
  1. Of the genes upregulated in plants overexpressing BAM8 and downregulated in bam7bam8 plants, many carry the cis-regulatory element in their promoters.
    [PMID: 21487098]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G45880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G45880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2273230.0AK227323.1 Arabidopsis thaliana mRNA for putative beta-amylase, complete cds, clone: RAFL14-01-P19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182112.20.0beta-amylase 7
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLD7LD980.0D7LD98_ARALL; Beta-amylase
STRINGAT2G45880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4345912
MalvidsOGEM29452535
Publications ? help Back to Top
  1. Chia T, et al.
    A cytosolic glucosyltransferase is required for conversion of starch to sucrose in Arabidopsis leaves at night.
    Plant J., 2004. 37(6): p. 853-63
    [PMID:14996213]
  2. Guti
    Phylogenetic profiling of the Arabidopsis thaliana proteome: what proteins distinguish plants from other organisms?
    Genome Biol., 2004. 5(8): p. R53
    [PMID:15287975]
  3. Smith SM, et al.
    Diurnal changes in the transcriptome encoding enzymes of starch metabolism provide evidence for both transcriptional and posttranscriptional regulation of starch metabolism in Arabidopsis leaves.
    Plant Physiol., 2004. 136(1): p. 2687-99
    [PMID:15347792]
  4. Lloyd JR,Kossmann J,Ritte G
    Leaf starch degradation comes out of the shadows.
    Trends Plant Sci., 2005. 10(3): p. 130-7
    [PMID:15749471]
  5. Kaplan F,Guy CL
    RNA interference of Arabidopsis beta-amylase8 prevents maltose accumulation upon cold shock and increases sensitivity of PSII photochemical efficiency to freezing stress.
    Plant J., 2005. 44(5): p. 730-43
    [PMID:16297066]
  6. Sparla F,Costa A,Lo Schiavo F,Pupillo P,Trost P
    Redox regulation of a novel plastid-targeted beta-amylase of Arabidopsis.
    Plant Physiol., 2006. 141(3): p. 840-50
    [PMID:16698902]
  7. Calenge F, et al.
    Natural variation for carbohydrate content in Arabidopsis. Interaction with complex traits dissected by quantitative genetics.
    Plant Physiol., 2006. 141(4): p. 1630-43
    [PMID:16798941]
  8. Fulton DC, et al.
    Beta-AMYLASE4, a noncatalytic protein required for starch breakdown, acts upstream of three active beta-amylases in Arabidopsis chloroplasts.
    Plant Cell, 2008. 20(4): p. 1040-58
    [PMID:18390594]
  9. Reinhold H, et al.
    β-amylase-like proteins function as transcription factors in Arabidopsis, controlling shoot growth and development.
    Plant Cell, 2011. 23(4): p. 1391-403
    [PMID:21487098]
  10. Streb S,Zeeman SC
    Starch metabolism in Arabidopsis.
    Arabidopsis Book, 2012. 10: p. e0160
    [PMID:23393426]