PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G44910.1
Common NameATHB4, ATHB-4, HB4, T13E15.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 318aa    MW: 34815.8 Da    PI: 9.6041
Description homeobox-leucine zipper protein 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G44910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-18162216256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  AT2G44910.1 162 RKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 216
                  788899***********************************************98 PP

2HD-ZIP_I/II123.21.3e-39162251191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+ +LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+kev+eLr +l
  AT2G44910.1 162 RKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELR-AL 251
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-331124IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.8E-19143216IPR009057Homeodomain-like
SuperFamilySSF466893.34E-18148219IPR009057Homeodomain-like
PROSITE profilePS5007117.103158218IPR001356Homeobox domain
SMARTSM003895.0E-15160222IPR001356Homeobox domain
PfamPF000468.7E-16162216IPR001356Homeobox domain
CDDcd000862.42E-13162219No hitNo description
PROSITE patternPS000270193216IPR017970Homeobox, conserved site
PfamPF021831.6E-11218252IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.9E-26218261IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0009725Biological Processresponse to hormone
GO:0010218Biological Processresponse to far red light
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000191anatomysynergid
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGERDDGLGL SLSLGNSQQK EPSLRLNLMP LTTSSSSSSF QHMHNQNNNS HPQKIHNISW  60
THLFQSSGIK RTTAERNSDA GSFLRGFNVN RAQSSVAVVD LEEEAAVVSS PNSAVSSLSG  120
NKRDLAVARG GDENEAERAS CSRGGGSGGS DDEDGGNGDG SRKKLRLSKD QALVLEETFK  180
EHSTLNPKQK LALAKQLNLR ARQVEVWFQN RRARTKLKQT EVDCEYLKRC CDNLTEENRR  240
LQKEVSELRA LKLSPHLYMH MTPPTTLTMC PSCERVSSSA ATVTAAPSTT TTPTVVGRPS  300
PQRLTPWTAI SLQQKSGR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160166SRKKLRL
2210218RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.449570.0bud
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266814_at0.0
Expression AtlasAT2G44910-
AtGenExpressAT2G44910-
ATTED-IIAT2G44910-
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain protein whose expression displays a dependence on phyB for both red and far-red light response. Also involved in the shade avoidance syndrome.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. ATHB4 is a novel regulatory component of the shade avoidance syndrome transcriptional network which controls auxin, brassinosteroid and gibberellin-mediated growth.
    [PMID: 19392702]
  2. ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis.
    [PMID: 22918502]
  3. a genetic system consisting of HD-Zip II and HD-Zip III genes (ATHB2, ATHB4) cooperates in establishing bilateral symmetry and patterning along the adaxial-abaxial axis in the embryo as well as in controlling SAM activity
    [PMID: 23578926]
  4. HB4 works as a transcriptional cofactor in the regulation of the control of vegetation proximity.
    [PMID: 28805249]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G44910.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By transition from light to far-red light. {ECO:0000269|PubMed:8106086}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, Brassinosteroid, Gibberellin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G44910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412510.0AJ441251.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein ATHB4 (Athb4 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182018.10.0homeobox-leucine zipper protein 4
SwissprotP929530.0ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLA0A384LKZ10.0A0A384LKZ1_ARATH; HB4
TrEMBLC0SV860.0C0SV86_ARATH; Uncharacterized protein At2g44910 (Fragment)
STRINGAT2G44910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  3. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  4. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  5. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  6. Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF
    Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis.
    Plant Physiol., 2006. 141(1): p. 85-96
    [PMID:16565297]
  7. Khanna R, et al.
    Functional profiling reveals that only a small number of phytochrome-regulated early-response genes in Arabidopsis are necessary for optimal deetiolation.
    Plant Cell, 2006. 18(9): p. 2157-71
    [PMID:16891401]
  8. Ciarbelli AR, et al.
    The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy.
    Plant Mol. Biol., 2008. 68(4-5): p. 465-78
    [PMID:18758690]
  9. Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF
    ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings.
    Plant J., 2009. 59(2): p. 266-77
    [PMID:19392702]
  10. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  11. Fernandez-Calvino L, et al.
    Arabidopsis plasmodesmal proteome.
    PLoS ONE, 2011. 6(4): p. e18880
    [PMID:21533090]
  12. Bou-Torrent J, et al.
    ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis.
    Plant Signal Behav, 2012. 7(11): p. 1382-7
    [PMID:22918502]
  13. Turchi L, et al.
    Arabidopsis HD-Zip II transcription factors control apical embryo development and meristem function.
    Development, 2013. 140(10): p. 2118-29
    [PMID:23578926]
  14. Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I
    Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development.
    Plant Signal Behav, 2014.
    [PMID:23838958]
  15. Francisco M, et al.
    Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense.
    Front Plant Sci, 2016. 7: p. 1010
    [PMID:27462337]
  16. Gallemí M, et al.
    A non-DNA-binding activity for the ATHB4 transcription factor in the control of vegetation proximity.
    New Phytol., 2017. 216(3): p. 798-813
    [PMID:28805249]
  17. Carabelli M,Sessa G,Baima S,Morelli G,Ruberti I
    The Arabidopsis Athb-2 and -4 genes are strongly induced by far-red-rich light.
    Plant J., 1993. 4(3): p. 469-79
    [PMID:8106086]