PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G44745.1
Common NameAtWRKY12, F16B22.46, WRKY12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 218aa    MW: 24548 Da    PI: 8.7243
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G44745.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-32144201158
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh
  AT2G44745.1 144 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNH 201
                  59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-34129201IPR003657WRKY domain
SuperFamilySSF1182901.57E-28136201IPR003657WRKY domain
PROSITE profilePS5081129.585139201IPR003657WRKY domain
SMARTSM007741.3E-37144203IPR003657WRKY domain
PfamPF031063.2E-25145201IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MEGGGRRVFS NYDLQQVTSS STTIQENMNF LVPFEETNVL TFFSSSSSSS LSSPSFPIHN  60
SSSTTTTHAP LGFSNNLQGG GPLGSKVVND DQENFGGGTN NDAHSNSWWR SNSGSGDMKN  120
KVKIRRKLRE PRFCFQTKSD VDVLDDGYKW RKYGQKVVKN SLHPRSYYRC THNNCRVKKR  180
VERLSEDCRM VITTYEGRHN HIPSDDSTSP DHDCLSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-26135201874Probable WRKY transcription factor 4
1wj2_A1e-26135201874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128KIRRKLR
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266886_at0.0
Expression AtlasAT2G44745-
AtGenExpressAT2G44745-
ATTED-IIAT2G44745-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G44745.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G44745
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0289920.0BT028992.1 Arabidopsis thaliana At2g44745 mRNA, complete cds.
GenBankAF4048570.0AF404857.1 Arabidopsis thaliana WRKY transcription factor 12 (WRKY12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566025.21e-163putative WRKY transcription factor 12
SwissprotQ93WY41e-165WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLQ1PEU51e-163Q1PEU5_ARATH; At2g44745
STRINGAT2G44745.11e-162(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MalvidsOGEM60452546
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  4. Lasserre E,Jobet E,Llauro C,Delseny M
    AtERF38 (At2g35700), an AP2/ERF family transcription factor gene from Arabidopsis thaliana, is expressed in specific cell types of roots, stems and seeds that undergo suberization.
    Plant Physiol. Biochem., 2008. 46(12): p. 1051-61
    [PMID:18723362]