PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G43280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 206aa    MW: 24019.4 Da    PI: 9.2186
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G43280.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1851.1e-2637125290
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                  fY++Y++++GF +r+ + ++s+++g+i  r+f C+keg+  + + k  + r++r++tr gCka+++vk +++gkw++tk+++eHnH+l+
  AT2G43280.1  37 FYDDYSRRLGFVMRVMSCRRSEKDGRILARRFGCNKEGHCVSIRGKFGSVRKPRPSTREGCKAMIHVKYDRSGKWVITKFVKEHNHPLV 125
                  9**************************************999999989***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.7E-2437125IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEDEDDPTTK NSNNTDDFAI EPREGIIFES EDAAKMFYDD YSRRLGFVMR VMSCRRSEKD  60
GRILARRFGC NKEGHCVSIR GKFGSVRKPR PSTREGCKAM IHVKYDRSGK WVITKFVKEH  120
NHPLVVSPRE ARHTLDEKDK RIQELTIELR NKKRLCAAYK EQLDAFAKIV EEHSNQIAKK  180
VENVVNNLKE FEHLEHALLR SKQDAI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.369090.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible257374_at0.0
Expression AtlasAT2G43280-
AtGenExpressAT2G43280-
ATTED-IIAT2G43280-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G43280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G43280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0044090.0BT004409.1 Arabidopsis thaliana clone U20421 unknown protein (At2g43280) mRNA, complete cds.
GenBankBT0028910.0BT002891.1 Arabidopsis thaliana clone RAFL14-97-G02 (R20421) unknown protein (At2g43280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181857.21e-153far-red impaired responsive 1-like protein
SwissprotQ9SZL86e-25FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLQ84J941e-153Q84J94_ARATH; Far-red impaired responsive 1-like protein
STRINGAT2G43280.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3376727
MalvidsOGEM39182855
Publications ? help Back to Top
  1. Rohde A, et al.
    Molecular phenotyping of the pal1 and pal2 mutants of Arabidopsis thaliana reveals far-reaching consequences on phenylpropanoid, amino acid, and carbohydrate metabolism.
    Plant Cell, 2004. 16(10): p. 2749-71
    [PMID:15377757]