PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G43000.1
Common NameANAC042, F23E6.1, JUB1, NAC042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 275aa    MW: 31456.3 Da    PI: 8.2991
Description NAC domain containing protein 42
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G43000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.24e-50201433128
          NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                  pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+  + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v+s +   v
  AT2G43000.1  20 PGFRFHPTDEELLGYYLRRKVENKTIKL-ELIKQIDIYKYDPWDLPRVSSVGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATGIDKPVYS-NLDCV 115
                  9***************************.99***************7777799***************************************.9999* PP

          NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                  glkk+Lv+y g+a kg+ktdW+mhe+rl
  AT2G43000.1 116 GLKKSLVYYLGSAGKGTKTDWMMHEFRL 143
                  **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.08518167IPR003441NAC domain
SuperFamilySSF1019411.7E-5519166IPR003441NAC domain
PfamPF023651.7E-2520143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSGEGNLGKD HEEENEAPLP GFRFHPTDEE LLGYYLRRKV ENKTIKLELI KQIDIYKYDP  60
WDLPRVSSVG EKEWYFFCMR GRKYRNSVRP NRVTGSGFWK ATGIDKPVYS NLDCVGLKKS  120
LVYYLGSAGK GTKTDWMMHE FRLPSTTKTD SPAQQAEVWT LCRIFKRVTS QRNPTILPPN  180
RKPVITLTDT CSKTSSLDSD HTSHRTVDSM SHEPPLPQPQ NPYWNQHIVG FNQPTYTGND  240
NNLLMSFWNG NGGDFIGDSA SWDELRSVID GNTKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-532017319171NAC domain-containing protein 19
4dul_A2e-532017319171NAC domain-containing protein 19
1ut7_B2e-532017319171NO APICAL MERISTEM PROTEIN
1ut7_A2e-532017319171NO APICAL MERISTEM PROTEIN
1ut4_B2e-532017319171NO APICAL MERISTEM PROTEIN
1ut4_A2e-532017319171NO APICAL MERISTEM PROTEIN
3swp_D2e-532017322174NAC domain-containing protein 19
3swp_C2e-532017322174NAC domain-containing protein 19
3swp_B2e-532017322174NAC domain-containing protein 19
3swp_A2e-532017322174NAC domain-containing protein 19
3swm_D2e-532017322174NAC domain-containing protein 19
3swm_C2e-532017322174NAC domain-containing protein 19
3swm_B2e-532017322174NAC domain-containing protein 19
3swm_A2e-532017322174NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265260_at0.0
Expression AtlasAT2G43000-
AtGenExpressAT2G43000-
ATTED-IIAT2G43000-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269|PubMed:22345491}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Function -- GeneRIF ? help Back to Top
  1. ANAC042, a member of the NAM, ATAF1/2, and CUC2 (NAC) transcription factor family genes, is involved in camalexin biosynthesis induction.
    [PMID: 22295908]
  2. JUB1 is a reactive oxygen species-responsive NAC transcription factor that promotes leaf longevity.
    [PMID: 22345491]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G43000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Precocious senescence and lowered abiotic stress tolerance. {ECO:0000269|PubMed:22345491}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G43000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935870.0AB493587.1 Arabidopsis thaliana At2g43000 mRNA for hypothetical protein, partial cds, clone: RAAt2g43000.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181828.10.0NAC domain-containing protein 42
SwissprotQ9SK550.0NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLD7LJF20.0D7LJF2_ARALL; ANAC042
STRINGAT2G43000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM30628200
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Swindell WR
    The association among gene expression responses to nine abiotic stress treatments in Arabidopsis thaliana.
    Genetics, 2006. 174(4): p. 1811-24
    [PMID:17028338]
  4. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  5. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  6. Saga H, et al.
    Identification and characterization of ANAC042, a transcription factor family gene involved in the regulation of camalexin biosynthesis in Arabidopsis.
    Mol. Plant Microbe Interact., 2012. 25(5): p. 684-96
    [PMID:22295908]
  7. Wu A, et al.
    JUNGBRUNNEN1, a reactive oxygen species-responsive NAC transcription factor, regulates longevity in Arabidopsis.
    Plant Cell, 2012. 24(2): p. 482-506
    [PMID:22345491]
  8. Mehterov N, et al.
    Oxidative stress provokes distinct transcriptional responses in the stress-tolerant atr7 and stress-sensitive loh2 Arabidopsis thaliana mutants as revealed by multi-parallel quantitative real-time PCR analysis of ROS marker and antioxidant genes.
    Plant Physiol. Biochem., 2012. 59: p. 20-9
    [PMID:22710144]
  9. Shahnejat-Bushehri S,Mueller-Roeber B,Balazadeh S
    Arabidopsis NAC transcription factor JUNGBRUNNEN1 affects thermomemory-associated genes and enhances heat stress tolerance in primed and unprimed conditions.
    Plant Signal Behav, 2012. 7(12): p. 1518-21
    [PMID:23073024]
  10. Sudre D, et al.
    Iron-dependent modifications of the flower transcriptome, proteome, metabolome, and hormonal content in an Arabidopsis ferritin mutant.
    J. Exp. Bot., 2013. 64(10): p. 2665-88
    [PMID:23682113]
  11. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]