PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G42830.1
Common NameAGL5, F7D19.17, SHP2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 246aa    MW: 28156.7 Da    PI: 9.6807
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G42830.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65e-312473150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  AT2G42830.1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73
                 79***********************************************8 PP

2K-box112.34.9e-37971889100
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                   +ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL++keL++Le++Lek+++++RskK+e+l+++ie++qk+e elq++n++Lr+k+ e
  AT2G42830.1  97 ITEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKREIELQNDNMYLRSKITE 188
                  7899*************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.1E-401675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.3891676IPR002100Transcription factor, MADS-box
CDDcd002653.35E-431790No hitNo description
SuperFamilySSF554552.09E-321788IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-321838IPR002100Transcription factor, MADS-box
PfamPF003193.3E-262572IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-325374IPR002100Transcription factor, MADS-box
PfamPF014862.8E-26100186IPR002487Transcription factor, K-box
PROSITE profilePS5129715.097102192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0001380developmental stagesepals enclosing flower bud stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEGGASNEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPTITEA NTQYYQQEAS KLRRQIRDIQ  120
NLNRHILGES LGSLNFKELK NLESRLEKGI SRVRSKKHEM LVAEIEYMQK REIELQNDNM  180
YLRSKITERT GLQQQESSVI HQGTVYESGV TSSHQSGQYN RNYIAVNLLE PNQNSSNQDQ  240
PPLQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-201684169Myocyte-specific enhancer factor 2B
1tqe_Q5e-201684169Myocyte-specific enhancer factor 2B
1tqe_R5e-201684169Myocyte-specific enhancer factor 2B
1tqe_S5e-201684169Myocyte-specific enhancer factor 2B
6c9l_A5e-201684169Myocyte-specific enhancer factor 2B
6c9l_B5e-201684169Myocyte-specific enhancer factor 2B
6c9l_C5e-201684169Myocyte-specific enhancer factor 2B
6c9l_D5e-201684169Myocyte-specific enhancer factor 2B
6c9l_E5e-201684169Myocyte-specific enhancer factor 2B
6c9l_F5e-201684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.2840.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263988_at0.0
Expression AtlasAT2G42830-
AtGenExpressAT2G42830-
ATTED-IIAT2G42830-
Functional Description ? help Back to Top
Source Description
TAIRAGAMOUS [AG]-like MADS box protein (AGL5) involved in fruit development (valve margin and dehiscence zone differentiation). A putative direct target of AG. SHP2 has been shown to be a downstream gene of the complex formed by AG and SEP proteins (SEP4 alone does not form a functional complex with AG).
UniProtProbable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}.
Function -- GeneRIF ? help Back to Top
  1. Bisindolylmaleimide I abolishes the FGF2-mediated association of Shp2 tyrosine phosphatase with Frs2 and Gab1.
    [PMID: 17145761]
  2. SHP1/2 and TAGL1, while distinct in molecular function, regulate similar activities via their necessity for seed dispersal in Arabidopsis and tomato, respectively.
    [PMID: 19880793]
  3. The present work identifies a new function for SHP1 and SHP2 genes in promoting stigma, style and medial tissue development.
    [PMID: 19900437]
  4. The stk shp1 shp2 ant quadruple mutant ovule lacks integument development as in ant single mutant.
    [PMID: 20041269]
  5. Gab1/SHP2/p38MAPK signaling pathway and Ang-2 have an essential role in regulating thrombin-induced monocyte adhesion and vascular leakage
    [PMID: 27241812]
  6. Study identified new roles for SHP1 and SHP2: they are required for synchronized ovule maturation and subsequent fertilization/seed maturation, seed mucilage production, and have an inhibitory effect which is antagonistic to the ABS function in controlling formative divisions and cell shape of the inner integument and seed coat layers.
    [PMID: 27776173]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G42830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G45190 (A), AT4G09960 (A), AT4G36920 (R), AT5G02030 (R), AT5G60910 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G00120(A), AT5G67110(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G45650, AT2G45660, AT3G57230, AT4G37940, AT5G13790, AT5G15800, AT1G24260, AT1G48150
IntActSearch P29385
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G42830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHAGL5A0.0M55553.1 Arabidopsis thaliana transcription factor (AGL5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565986.10.0K-box region and MADS-box transcription factor family protein
SwissprotP293850.0AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLQ5XXG91e-179Q5XXG9_ARATH; SHATTERPROOF2
STRINGAT2G42830.21e-178(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Liljegren SJ, et al.
    SHATTERPROOF MADS-box genes control seed dispersal in Arabidopsis.
    Nature, 2000. 404(6779): p. 766-70
    [PMID:10783890]
  2. Smyth D
    A reverse trend--MADS functions revealed.
    Trends Plant Sci., 2000. 5(8): p. 315-7
    [PMID:10908873]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. M
    The MADS-box gene DEFH28 from Antirrhinum is involved in the regulation of floral meristem identity and fruit development.
    Plant J., 2001. 28(2): p. 169-79
    [PMID:11722760]
  5. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  6. Favaro R, et al.
    MADS-box protein complexes control carpel and ovule development in Arabidopsis.
    Plant Cell, 2003. 15(11): p. 2603-11
    [PMID:14555696]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Bao X,Franks RG,Levin JZ,Liu Z
    Repression of AGAMOUS by BELLRINGER in floral and inflorescence meristems.
    Plant Cell, 2004. 16(6): p. 1478-89
    [PMID:15155890]
  9. Moore RC,Grant SR,Purugganan MD
    Molecular population genetics of redundant floral-regulatory genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2005. 22(1): p. 91-103
    [PMID:15371526]
  10. Lee JY, et al.
    Activation of CRABS CLAW in the Nectaries and Carpels of Arabidopsis.
    Plant Cell, 2005. 17(1): p. 25-36
    [PMID:15598802]
  11. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  12. Kaufmann K,Anfang N,Saedler H,Theissen G
    Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein.
    Mol. Genet. Genomics, 2005. 274(2): p. 103-18
    [PMID:16080001]
  13. Causier B, et al.
    Evolution in action: following function in duplicated floral homeotic genes.
    Curr. Biol., 2005. 15(16): p. 1508-12
    [PMID:16111944]
  14. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  15. Battaglia R,Brambilla V,Colombo L,Stuitje AR,Kater MM
    Functional analysis of MADS-box genes controlling ovule development in Arabidopsis using the ethanol-inducible alc gene-expression system.
    Mech. Dev., 2006. 123(4): p. 267-76
    [PMID:16515858]
  16. Ma H,Yanofsky MF,Meyerowitz EM
    AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes.
    Genes Dev., 1991. 5(3): p. 484-95
    [PMID:1672119]
  17. de Folter S, et al.
    A Bsister MADS-box gene involved in ovule and seed development in petunia and Arabidopsis.
    Plant J., 2006. 47(6): p. 934-46
    [PMID:16925602]
  18. Balanz
    Patterning the female side of Arabidopsis: the importance of hormones.
    J. Exp. Bot., 2006. 57(13): p. 3457-69
    [PMID:17023565]
  19. Krejci P, et al.
    Bisindolylmaleimide I suppresses fibroblast growth factor-mediated activation of Erk MAP kinase in chondrocytes by preventing Shp2 association with the Frs2 and Gab1 adaptor proteins.
    J. Biol. Chem., 2007. 282(5): p. 2929-36
    [PMID:17145761]
  20. Brambilla V, et al.
    Genetic and molecular interactions between BELL1 and MADS box factors support ovule development in Arabidopsis.
    Plant Cell, 2007. 19(8): p. 2544-56
    [PMID:17693535]
  21. Liu Z,Zhou C,Wu K
    Creation and analysis of a novel chimeric promoter for the complete containment of pollen- and seed-mediated gene flow.
    Plant Cell Rep., 2008. 27(6): p. 995-1004
    [PMID:18317776]
  22. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  23. Mitsuda N,Ohme-Takagi M
    NAC transcription factors NST1 and NST3 regulate pod shattering in a partially redundant manner by promoting secondary wall formation after the establishment of tissue identity.
    Plant J., 2008. 56(5): p. 768-78
    [PMID:18657234]
  24. Mummenhoff K,Polster A,M
    Lepidium as a model system for studying the evolution of fruit development in Brassicaceae.
    J. Exp. Bot., 2009. 60(5): p. 1503-13
    [PMID:19052256]
  25. Chang IF, et al.
    Proteomic profiling of tandem affinity purified 14-3-3 protein complexes in Arabidopsis thaliana.
    Proteomics, 2009. 9(11): p. 2967-85
    [PMID:19452453]
  26. Mitsuda N,Ohme-Takagi M
    Functional analysis of transcription factors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(7): p. 1232-48
    [PMID:19478073]
  27. Vrebalov J, et al.
    Fleshy fruit expansion and ripening are regulated by the Tomato SHATTERPROOF gene TAGL1.
    Plant Cell, 2009. 21(10): p. 3041-62
    [PMID:19880793]
  28. Colombo M, et al.
    A new role for the SHATTERPROOF genes during Arabidopsis gynoecium development.
    Dev. Biol., 2010. 337(2): p. 294-302
    [PMID:19900437]
  29. Losa A,Colombo M,Brambilla V,Colombo L
    Genetic interaction between AINTEGUMENTA (ANT) and the ovule identity genes SEEDSTICK (STK), SHATTERPROOF1 (SHP1) and SHATTERPROOF2 (SHP2).
    Sex. Plant Reprod., 2010. 23(2): p. 115-21
    [PMID:20041269]
  30. Irish VF
    The flowering of Arabidopsis flower development.
    Plant J., 2010. 61(6): p. 1014-28
    [PMID:20409275]
  31. Matias-Hernandez L, et al.
    VERDANDI is a direct target of the MADS domain ovule identity complex and affects embryo sac differentiation in Arabidopsis.
    Plant Cell, 2010. 22(6): p. 1702-15
    [PMID:20581305]
  32. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  33. Yang Y,Karlson DT
    Overexpression of AtCSP4 affects late stages of embryo development in Arabidopsis.
    J. Exp. Bot., 2011. 62(6): p. 2079-91
    [PMID:21282328]
  34. Gomez MD,Urbez C,Perez-Amador MA,Carbonell J
    Characterization of constricted fruit (ctf) mutant uncovers a role for AtMYB117/LOF1 in ovule and fruit development in Arabidopsis thaliana.
    PLoS ONE, 2011. 6(4): p. e18760
    [PMID:21533201]
  35. Severing EI, et al.
    Predicting the impact of alternative splicing on plant MADS domain protein function.
    PLoS ONE, 2012. 7(1): p. e30524
    [PMID:22295091]
  36. M
    Evidence that an evolutionary transition from dehiscent to indehiscent fruits in Lepidium (Brassicaceae) was caused by a change in the control of valve margin identity genes.
    Plant J., 2013. 73(5): p. 824-35
    [PMID:23173897]
  37. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  38. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  39. Rathnakumar K, et al.
    Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability.
    J. Thromb. Haemost., 2016. 14(8): p. 1655-67
    [PMID:27241812]
  40. Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L
    Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks.
    Development, 2016. 143(18): p. 3372-81
    [PMID:27510967]
  41. Ehlers K, et al.
    The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana.
    PLoS ONE, 2016. 11(10): p. e0165075
    [PMID:27776173]
  42. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  43. Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
    Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
    Development, 2018.
    [PMID:29361563]
  44. Savidge B,Rounsley SD,Yanofsky MF
    Temporal relationship between the transcription of two Arabidopsis MADS box genes and the floral organ identity genes.
    Plant Cell, 1995. 7(6): p. 721-33
    [PMID:7647563]