PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G42660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 255aa    MW: 28913.8 Da    PI: 9.7069
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G42660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-3151104255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH +Fv+av++LGG+++AtPk +le+m++kgL+++hvkSHLQ+YR+
  AT2G42660.1  51 PRLRWTPDLHLSFVRAVQRLGGPDRATPKLVLEMMNLKGLSIAHVKSHLQMYRS 104
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2947105IPR009057Homeodomain-like
PROSITE profilePS5129410.66447107IPR017930Myb domain
SuperFamilySSF466892.15E-1451105IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-2351106IPR006447Myb domain, plants
PfamPF002492.3E-952103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MAGRSSPGKC STWLDLNREE TVEKNNEEES SVEDEDQITN NVRQYIRSNM PRLRWTPDLH  60
LSFVRAVQRL GGPDRATPKL VLEMMNLKGL SIAHVKSHLQ MYRSKKLEPS SRPGFGAFMS  120
GQRSYLMDMI DSRCIPHSDL RHAYNSKTVP SRVLNQDAVV TNLGGNFLMR PSSWFSGLCR  180
NDRDSTENKT LPLLEIRKKN NEKRVRDEEV SSVKRLKSMS GGGIQLPEFG NCRQKPTDDI  240
NTMLSLSLLS TSSEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-1852106357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-1852106357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-1852106357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-1852106357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263977_at0.0
Expression AtlasAT2G42660-
AtGenExpressAT2G42660-
ATTED-IIAT2G42660-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G42660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G42660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0746400.0AY074640.1 Arabidopsis thaliana F14N22.7/F14N22.7 mRNA, complete cds.
GenBankAY0789380.0AY078938.1 Arabidopsis thaliana At2g45350/F14N22.7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181794.10.0Homeodomain-like superfamily protein
TrEMBLQ9SJJ00.0Q9SJJ0_ARATH; At2g45350/F14N22.7
STRINGAT2G42660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Representative plantOGRP28515123
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]