PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G42400.1
Common NameATVOZ2, MHK10.12, VOZ2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family VOZ
Protein Properties Length: 450aa    MW: 50566.1 Da    PI: 4.9575
Description vascular plant one zinc finger protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G42400.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ426.24.9e-1312214352216
          VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                  ppsaflgpkcalwdctrpaqgsew+ dycs++h tlalne++pgt+pvlrp+gi+lkd+ll++al+ak+qgk+vgip+cega+++k+pwnaaelf+l+
  AT2G42400.1 221 PPSAFLGPKCALWDCTRPAQGSEWYLDYCSNYHGTLALNEDSPGTAPVLRPGGISLKDNLLIDALRAKTQGKNVGIPVCEGAVNTKCPWNAAELFHLE 318
                  7************************************************************************************************* PP

          VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksak 197
                  l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++g+krsyymdpqp++ fewhl+ey+ine+da+alyrlelk+ ++kks+k
  AT2G42400.1 319 LVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQEGQKRSYYMDPQPPGPFEWHLFEYQINESDACALYRLELKVGNGKKSPK 416
                  ************************************************************************************************** PP

          VOZ 198 gkvskdsladlqkklgrlt 216
                  gk+skd+ladlqkk+g+++
  AT2G42400.1 417 GKISKDPLADLQKKMGQFK 435
                  ****************986 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009067anatomyfilament
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MSNHPKITSA HQNVEEKLRE LQERFCHLQA ARKEGRHGDL ALLEAQISQN IREWQAELTA  60
PSPESSLLGE GISQFLEEFA PLLKLDEEDD ATSTLKEHAG AKPDPEGFSQ SLCPPEWTSE  120
NFSQSPFNGN FSCGFEDALN STETHGQQLH YGYEGFDPSI NSAPDFHDQK LSSNLDITSQ  180
YDYIFSEVRQ ELDNSPSTKL DSSEEIDNFA EFSTPSSVRV PPSAFLGPKC ALWDCTRPAQ  240
GSEWYLDYCS NYHGTLALNE DSPGTAPVLR PGGISLKDNL LIDALRAKTQ GKNVGIPVCE  300
GAVNTKCPWN AAELFHLELV EGETIREWLF FDKPRRAYDS GNRKQRSLPD YSGRGWHESR  360
KQLMKEQEGQ KRSYYMDPQP PGPFEWHLFE YQINESDACA LYRLELKVGN GKKSPKGKIS  420
KDPLADLQKK MGQFKVASDK PSPPTKGRKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.287160.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865074440.0
Genevisible265827_at0.0
Expression AtlasAT2G42400-
AtGenExpressAT2G42400-
ATTED-IIAT2G42400-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles and mesophyll cells of various tissues. Expressed in the root, especially in the root tip. Also detected in stamen filaments, stipules and anthers. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Function -- GeneRIF ? help Back to Top
  1. VOZ1 and VOZ2 function in the vascular bundle to regulate flowering.
    [PMID: 22904146]
  2. Vascular plant one-zinc-finger proteins (VOZs) function as both negative and positive regulators of the abiotic and biotic stress-responsive pathways, and control Arabidopsis adaptation to various stress conditions.
    [PMID: 23167462]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00018PBM25378322Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G42400.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SLB9
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype. Voz1 and voz2 double mutant displays a late flowering phenotype under long-day conditions. {ECO:0000269|PubMed:22904146}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G42400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0780480.0AY078048.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
GenBankAB1252570.0AB125257.1 Arabidopsis thaliana AtVOZ2 mRNA for Transcription factor AtVOZ2, complete cds.
GenBankAF3618310.0AF361831.1 Arabidopsis thaliana At2g42400/MHK10.12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565972.10.0vascular plant one zinc finger protein 2
SwissprotQ9SLB90.0VOZ2_ARATH; Transcription factor VOZ2
TrEMBLD7MXH80.0D7MXH8_ARALL; Putative uncharacterized protein
STRINGAT2G42400.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23271335
MalvidsOGEM110602534
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Mitsuda N,Hisabori T,Takeyasu K,Sato MH
    VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(7): p. 845-54
    [PMID:15295067]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  5. Yasui Y, et al.
    The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.
    Plant Cell, 2012. 24(8): p. 3248-63
    [PMID:22904146]
  6. Nakai Y, et al.
    Vascular plant one-zinc-finger protein 1/2 transcription factors regulate abiotic and biotic stress responses in Arabidopsis.
    Plant J., 2013. 73(5): p. 761-75
    [PMID:23167462]
  7. Nakai Y,Fujiwara S,Kubo Y,Sato MH
    Overexpression of VOZ2 confers biotic stress tolerance but decreases abiotic stress resistance in Arabidopsis.
    Plant Signal Behav, 2013. 8(3): p. e23358
    [PMID:23299334]
  8. Celesnik H,Ali GS,Robison FM,Reddy AS
    Arabidopsis thaliana VOZ (Vascular plant One-Zinc finger) transcription factors are required for proper regulation of flowering time.
    Biol Open, 2013. 2(4): p. 424-31
    [PMID:23616927]