PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G42380.2
Common NameATBZIP34, BZIP34, MHK10.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 321aa    MW: 35806.2 Da    PI: 5.8287
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G42380.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-10188231548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  AT2G42380.2 188 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 231
                  8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-13184248IPR004827Basic-leucine zipper domain
PfamPF077164.4E-9186233IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.622186238IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.66E-11188242No hitNo description
Gene3DG3DSA:1.20.5.1704.2E-13188239No hitNo description
CDDcd147032.09E-23189239No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MAQLPPKIPN MTQHWPDFSS QKLSPFSTPT ATAVATATTT VQNPSWVDEF LDFSASRRGN  60
HRRSISDSIA FLEAPTVSIE DHQFDRFDDE QFMSMFTDDD NLHSNPSHIN NKNNNVGPTG  120
SSSNTSTPSN SFNDDNKELP PSDHNMNNNI NNNYNDEVQS QCKMEPEDGT ASNNNSGDSS  180
GNRILDPKRV KRILANRQSA QRSRVRKLQY ISELERSVTS LQAEVSVLSP RVAFLDHQRL  240
LLNVDNSALK QRIAALSQDK LFKDAHQEAL KREIERLRQV YNQQSLTNVE NANHLSATGA  300
GATPAVDIKS SVETEQLLNV S
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265877_at1e-173
Expression AtlasAT2G42380-
AtGenExpressAT2G42380-
ATTED-IIAT2G42380-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vascular tissues of leaves, stems and siliques, anthers, filaments, tapetum, mature pollen grains, pistil vascular tissues and papillar cells, and funiculi. {ECO:0000269|PubMed:19449183}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the BZIP family of transcription factors. Forms heterodimers with the related protein AtbZIP61. Binds to G-boxes in vitro and is localized to the nucleus in onion epidermal cells.
UniProtTranscriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269|PubMed:17719007, ECO:0000269|PubMed:19449183}.
Function -- GeneRIF ? help Back to Top
  1. Data suggest a mode of action of AtbZIP34 in several metabolic pathways, namely regulation of lipid metabolism and/or cellular transport.
    [PMID: 19449183]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G42380.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G42380, AT5G38800, AT1G43700
IntActSearch F4IN23
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Pollen morphological defects, reduced pollen germination efficiency and pollen tube growth. {ECO:0000269|PubMed:19449183}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G42380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0746570.0AY074657.1 Arabidopsis thaliana At2g42380/MHK10.10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850369.10.0transcription factor BZIP34
SwissprotF4IN230.0BZP34_ARATH; Basic leucine zipper 34
TrEMBLD7LI530.0D7LI53_ARALL; BZIP transcription factor family protein
STRINGAT2G42380.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MalvidsOGEM17532777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  6. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  7. Shen H,Cao K,Wang X
    A conserved proline residue in the leucine zipper region of AtbZIP34 and AtbZIP61 in Arabidopsis thaliana interferes with the formation of homodimer.
    Biochem. Biophys. Res. Commun., 2007. 362(2): p. 425-30
    [PMID:17719007]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Gibalová A, et al.
    AtbZIP34 is required for Arabidopsis pollen wall patterning and the control of several metabolic pathways in developing pollen.
    Plant Mol. Biol., 2009. 70(5): p. 581-601
    [PMID:19449183]
  10. Reňák D,Dupl'áková N,Honys D
    Wide-scale screening of T-DNA lines for transcription factor genes affecting male gametophyte development in Arabidopsis.
    Sex. Plant Reprod., 2012. 25(1): p. 39-60
    [PMID:22101548]