PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G40970.1
Common NameMYBC1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 248aa    MW: 27554.4 Da    PI: 9.5557
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G40970.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.9e-30105158155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  AT2G40970.1 105 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 158
                  59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.19102161IPR017930Myb domain
SuperFamilySSF466891.0E-19102162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-30104163IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-24106158IPR006447Myb domain, plants
PfamPF002496.7E-7108157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009066anatomyanther
PO:0009067anatomyfilament
PO:0009073anatomystigma
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MREDNPNWFL RWEEELPSPE ELIPISQTLI TPHLALAFQI GSPNHHLGSK RTTAIYHQKL  60
QSSTTPTTPT PTPPPMMMNS DFGGGDSTDL GSGSIGGEPA RTLKRPRLVW TPQLHKRFVD  120
AVGHLGIKNA VPKTIMQLMS VEGLTRENVA SHLQKYRLYL RRMQGGNGNG ITGGHVIVSD  180
SATDRLFASS PVPAHFLSPD YLMPPLEHSY MGKHVITQQN QVVRNLRYED SEYGHGSMKM  240
LKLFPAGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-32105161157Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.277760.0root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306884860.0
Genevisible267077_at0.0
Expression AtlasAT2G40970-
AtGenExpressAT2G40970-
ATTED-IIAT2G40970-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Function -- GeneRIF ? help Back to Top
  1. MYBC1 is capable of negatively regulating the freezing tolerance of Arabidopsis in the CBF-independent pathway. [MYBC1]
    [PMID: 20331973]
  2. Data show that a myb family transcription factor MTF1 (MYBC1; At2g40970) inhibited plant transformation susceptibility.
    [PMID: 24255177]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G40970.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G40970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0024090.0AC002409.3 Arabidopsis thaliana chromosome 2 clone T20B5 map CIC11C08, complete sequence.
GenBankAC0042610.0AC004261.3 Arabidopsis thaliana chromosome 2 clone T3K9 map CIC11C08, complete sequence.
GenBankAY0723810.0AY072381.1 Arabidopsis thaliana unknown protein (At2g40970) mRNA, complete cds.
GenBankBT0000980.0BT000098.1 Arabidopsis thaliana unknown protein (At2g40970) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181630.10.0Homeodomain-like superfamily protein
SwissprotO222100.0MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A178VYV10.0A0A178VYV1_ARATH; MYBC1
STRINGAT2G40970.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Representative plantOGRP11571753
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hazen SP, et al.
    LUX ARRHYTHMO encodes a Myb domain protein essential for circadian rhythms.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(29): p. 10387-92
    [PMID:16006522]
  3. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  4. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  5. Skirycz A, et al.
    The DOF transcription factor OBP1 is involved in cell cycle regulation in Arabidopsis thaliana.
    Plant J., 2008. 56(5): p. 779-92
    [PMID:18665917]
  6. Li Y, et al.
    Genome-wide identification of osmotic stress response gene in Arabidopsis thaliana.
    Genomics, 2008. 92(6): p. 488-93
    [PMID:18804526]
  7. Zhai H, et al.
    A single-repeat R3-MYB transcription factor MYBC1 negatively regulates freezing tolerance in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2010. 394(4): p. 1018-23
    [PMID:20331973]
  8. Sardesai N, et al.
    Cytokinins secreted by Agrobacterium promote transformation by repressing a plant myb transcription factor.
    Sci Signal, 2013. 6(302): p. ra100
    [PMID:24255177]
  9. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]