PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G40470.1
Common NameASL11, LBD15, T2P4.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 224aa    MW: 24660 Da    PI: 8.8092
Description LOB domain-containing protein 15
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G40470.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.77.1e-42451441100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael +++
  AT2G40470.1  45 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQALQAELTAVR 142
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  AT2G40470.1 143 SE 144
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.90744145IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4245142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSRERERFEE IGKKIKREAD AWPHQMAGIR RPMSGPPGTL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PHKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQALQAELTA VRSEILKYKQ REAVATLIVP SNSQVAGFHN SGGVSVIAPP  180
PQRPTTPPQP TTAHPPSPSS CVFSQPTTRD LEYGNIESEN NYFG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.274260.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible255823_at0.0
Expression AtlasAT2G40470-
AtGenExpressAT2G40470-
ATTED-IIAT2G40470-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Function -- GeneRIF ? help Back to Top
  1. ASL11 might be involved in sustaining indeterminate cell fate of shoot apical meristems.
    [PMID: 20306306]
  2. Results suggest that ASL11/LBD15 affects cellular differentiation in the SAM and regulates WUS expression.
    [PMID: 23397191]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G40470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8L5T5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G40470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252880.0BT025288.1 Arabidopsis thaliana At2g40470 mRNA, complete cds.
GenBankAB4738440.0AB473844.1 Arabidopsis thaliana ASL11 mRNA for ASYMMETRIC LEAVES2-like 11 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565933.11e-167LOB domain-containing protein 15
SwissprotQ8L5T51e-169LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A087H4761e-147A0A087H476_ARAAL; Uncharacterized protein
STRINGAT2G40470.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MalvidsOGEM19272781
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Sunkar R,Zhu JK
    Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis.
    Plant Cell, 2004. 16(8): p. 2001-19
    [PMID:15258262]
  4. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  6. Chang IF, et al.
    Proteomic profiling of tandem affinity purified 14-3-3 protein complexes in Arabidopsis thaliana.
    Proteomics, 2009. 9(11): p. 2967-85
    [PMID:19452453]
  7. Sun SB,Meng LS,Sun XD,Feng ZH
    Using high competent shoot apical meristems of cockscomb as explants for studying function of ASYMMETRIC LEAVES2-LIKE11 (ASL11) gene of Arabidopsis.
    Mol. Biol. Rep., 2010. 37(8): p. 3973-82
    [PMID:20306306]
  8. Sun X,Feng Z,Meng L,Zhu J,Geitmann A
    Arabidopsis ASL11/LBD15 is involved in shoot apical meristem development and regulates WUS expression.
    Planta, 2013. 237(5): p. 1367-78
    [PMID:23397191]