PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G40260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 410aa    MW: 46231.7 Da    PI: 6.765
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G40260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.6e-3283136255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtpeLH +F++ave+LGG+++AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  AT2G40260.1  83 PRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRS 136
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-3079137IPR009057Homeodomain-like
PROSITE profilePS5129413.11779139IPR017930Myb domain
SuperFamilySSF466894.3E-1680138IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-2483138IPR006447Myb domain, plants
PfamPF002492.3E-984135IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MRSSSQNSEN SKTCLSNNIK ATTKNEEDKD EEDDEEGEED EEERSGDQSP SSNSYEEESG  60
SHHHDQNKKN GGSVRPYNRS KTPRLRWTPE LHICFLQAVE RLGGPDRATP KLVLQLMNVK  120
GLSIAHVKSH LQMYRSKKTD EPNEGDQGFS FEHGAGYTYN LSQLPMLQSF DQRPSSSLGY  180
GGGSWTDHRR QIYRSPWRGL TTRENTRTRQ TMFSSQPGER YHGVSNSILN DKNKTISFRI  240
NSHEGVHDNN GVAGAVPRIH RSFLEGMKTF NKSWGQSLSS NLKSSTATIP QDHIATTLNS  300
YQWENAGVAE GSENVLKRKR LLFSDDCNKS DQDLDLSLSL KVPRTHDNLG ECLLEDEVKE  360
HDDHQDIKSL SLSLSSSGSS KLDRTIRKED QTDHKKRKIS VLASPLDLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1784138357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1784138357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1784138357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1784138357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184053240.0
Genevisible263830_at0.0
Expression AtlasAT2G40260-
AtGenExpressAT2G40260-
ATTED-IIAT2G40260-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G40260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G51190
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G40260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0070200.0AC007020.5 Arabidopsis thaliana chromosome 2 clone T3G21 map g4514, complete sequence.
GenBankAF0852790.0AF085279.1 Arabidopsis thaliana ABA-regulated gene cluster, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181555.10.0Homeodomain-like superfamily protein
TrEMBLQ9SIZ50.0Q9SIZ5_ARATH; Homeodomain-like superfamily protein
STRINGAT2G40260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Representative plantOGRP28515123
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]