PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G40210.1
Common NameAGL48, T07M07.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 371aa    MW: 42414.2 Da    PI: 9.3268
Description AGAMOUS-like 48
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G40210.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.22.2e-131151343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 ien+  r +++ k r g+lKK +EL +LC++++ viifs++
  AT2G40210.1 11 IENDKSRATSLQKMRVGLLKKVKELTILCAVRAIVIIFSPD 51
                 9**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-15160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.343149IPR002100Transcription factor, MADS-box
CDDcd002664.48E-28285No hitNo description
SuperFamilySSF554554.32E-18294IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-5323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-121151IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MTRKKVKLVW IENDKSRATS LQKMRVGLLK KVKELTILCA VRAIVIIFSP DKVGPLVWPS  60
PQATHGLLDE FFALPKSVQK KKESNVESYL KEKTHKFQEQ LKKSKKKNKE HVIDELMMQL  120
QSGREIADLN QSEMYALLSF SRDTILLCRK KLAFMQFPPL RDPPVFPFEI QVEEFKTTTN  180
DGFVGGGQDN KRAGRTDEAT RFINTDIFKQ SKSYYFFDEW VFPPSPPKYE IPQQMENGNP  240
NPKSYRLYQG SSSNGNPHLE MDPFRLQMMT SQGLAGSVSQ PLQHHSMINN PTMAMNQPSQ  300
DPFDYMRSEL GINEGININN SQFYMSNNTI TANDGVRQEP YPNVTTAGEN NGDATTSNTN  360
MVWPGFNNHH F
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184053080.0
Genevisible263381_at0.0
Expression AtlasAT2G40210-
AtGenExpressAT2G40210-
ATTED-IIAT2G40210-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G40210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G40210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0852790.0AF085279.1 Arabidopsis thaliana ABA-regulated gene cluster, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181550.10.0AGAMOUS-like 48
TrEMBLA0A178VQF20.0A0A178VQF2_ARATH; AGL48
TrEMBLQ9XEF10.0Q9XEF1_ARATH; AGAMOUS-like 48
STRINGAT2G40210.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Publications ? help Back to Top
  1. Wang ML, et al.
    A cluster of ABA-regulated genes on Arabidopsis thaliana BAC T07M07.
    Genome Res., 1999. 9(4): p. 325-33
    [PMID:10207155]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]