PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G39880.1
Common NameAtMYB25, MYB25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 367aa    MW: 40912.3 Da    PI: 7.9125
Description myb domain protein 25
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G39880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-165095147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W +e de l ++vk+ G+++W++I+r ++ gR++k+c++rw + 
      AT2G39880.1 50 KGPWLPEQDEALTRLVKMCGPRNWNLISRGIP-GRSGKSCRLRWCNQ 95
                     79******************************.***********985 PP

2Myb_DNA-binding45.41.9e-14102146147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eE+  +  a + lG++ W+ Ia+ ++ gRt++ +k++w++ 
      AT2G39880.1 102 RKPFSDEEEHMIMSAQAVLGNK-WSVIAKLLP-GRTDNAIKNHWNSN 146
                      789*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.39645100IPR017930Myb domain
SuperFamilySSF466896.25E-2847143IPR009057Homeodomain-like
SMARTSM007171.2E-134998IPR001005SANT/Myb domain
PfamPF002499.4E-155095IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2251103IPR009057Homeodomain-like
CDDcd001672.48E-125294No hitNo description
PROSITE profilePS5129418.499101151IPR017930Myb domain
SMARTSM007175.7E-12101149IPR001005SANT/Myb domain
PfamPF002491.0E-12102146IPR001005SANT/Myb domain
CDDcd001673.33E-8104147No hitNo description
Gene3DG3DSA:1.10.10.606.2E-21104150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009555Biological Processpollen development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020094anatomyplant egg cell
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MNGEISRPPE LISSRNPCKS FENAIHKAVE AELAELAKSD ANGGGKSKVK GPWLPEQDEA  60
LTRLVKMCGP RNWNLISRGI PGRSGKSCRL RWCNQLDPIL KRKPFSDEEE HMIMSAQAVL  120
GNKWSVIAKL LPGRTDNAIK NHWNSNLRRK PAEQWKIPLL MSNTEIVYQL YPSMVRRISN  180
ASPKEHLPQE EETGVLSDDK MDDEAKEPPR EQNSKTGVYR PVARMGAFSV CKPGYMAPCE  240
GPLVQASRPD SLAGKFLQSL CYDPIIPSKC GHGCCNHQDS TTLSSSSVLG SEFVDYEEHS  300
SAELDKELIS ISNDLNNTAW IRSGKEAEQS LKADDQFRRE YAHSKFSGMV NNGVSSQMVR  360
QDLRALS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-35491503104MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-344915057158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-344915057158MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-35491503104C-Myb DNA-Binding Domain
1msf_C6e-35491503104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233080.0
Genevisible267354_at0.0
Expression AtlasAT2G39880-
AtGenExpressAT2G39880-
ATTED-IIAT2G39880-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB25).
UniProtRequired for male gametophyte (pollen) development. {ECO:0000269|PubMed:22101548}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G39880.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: May be the target of the microRNA (miRNA) MIR393a. {ECO:0000269|PubMed:15258262}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G39880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759880.0AF175988.1 Arabidopsis thaliana putative transcription factor (MYB25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181517.10.0myb domain protein 25
SwissprotO041920.0MYB25_ARATH; Transcription factor MYB25
TrEMBLA0A178VQ620.0A0A178VQ62_ARATH; MYB25
STRINGAT2G39880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Jiang C,Gu X,Peterson T
    Identification of conserved gene structures and carboxy-terminal motifs in the Myb gene family of Arabidopsis and Oryza sativa L. ssp. indica.
    Genome Biol., 2004. 5(7): p. R46
    [PMID:15239831]
  4. Sunkar R,Zhu JK
    Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis.
    Plant Cell, 2004. 16(8): p. 2001-19
    [PMID:15258262]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  8. Reňák D,Dupl'áková N,Honys D
    Wide-scale screening of T-DNA lines for transcription factor genes affecting male gametophyte development in Arabidopsis.
    Sex. Plant Reprod., 2012. 25(1): p. 39-60
    [PMID:22101548]
  9. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  10. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]