PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G38300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 340aa    MW: 38925.2 Da    PI: 9.2095
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G38300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-3255108255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH rFv+ave+LGG+e+AtPk ++++m++kgL+++hvkSHLQ+YR+
  AT2G38300.1  55 PRLRWTPDLHLRFVRAVERLGGQERATPKLVRQMMNIKGLSIAHVKSHLQMYRS 108
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.75951111IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2951109IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1453109IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2255110IPR006447Myb domain, plants
PfamPF002491.2E-956107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009047anatomystem
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MIPSMEGGGK TNREEEEEEE EEEEEGEESK VSSNSTVEES DKKTKVRPYV RSKVPRLRWT  60
PDLHLRFVRA VERLGGQERA TPKLVRQMMN IKGLSIAHVK SHLQMYRSKK IDDQGQAIAG  120
HKHLFETSTD RNIYKLSQLP MFRGYNHNHD SPFRYGSKIS NASLWNSSSQ GTERSLIDQI  180
RPGLIRNASV SNNIRGSDYW TNNKSFQNIY SSSISNHFPK LRHDHHERTN SVTFNSIQGH  240
SRTFQKFHNG VEENTNHSYC SKTNGKRDAS RSIDLDLSLK LRQPEKTILE ETETAATTTD  300
QTLSLSLCPG SSSWKKSRLM KDEEDRTVKI GQESTLDLTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1556110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1556110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1556110357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1556110357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO795700990.0
Genevisible267089_at0.0
Expression AtlasAT2G38300-
AtGenExpressAT2G38300-
ATTED-IIAT2G38300-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G38300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G65210
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G38300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1176890.0AK117689.1 Arabidopsis thaliana At2g38300 mRNA for unknown protein, complete cds, clone: RAFL17-35-G17.
GenBankBT0049730.0BT004973.1 Arabidopsis thaliana clone U50495 unknown protein (At2g38300) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181364.20.0myb-like HTH transcriptional regulator family protein
TrEMBLA0A178VYP60.0A0A178VYP6_ARATH; Uncharacterized protein
TrEMBLQ8GYE40.0Q8GYE4_ARATH; Myb-like HTH transcriptional regulator family protein
STRINGAT2G38300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Representative plantOGRP28515123
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  3. Tamura K,Fukao Y,Iwamoto M,Haraguchi T,Hara-Nishimura I
    Identification and characterization of nuclear pore complex components in Arabidopsis thaliana.
    Plant Cell, 2010. 22(12): p. 4084-97
    [PMID:21189294]
  4. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  5. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]