PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G38250.1
Common NameF16M14.18, GT1L, GT3B, GT-3B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 289aa    MW: 34307.4 Da    PI: 7.0249
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G38250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix83.72.3e-2641123186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ +e+++Li +r e+++++ ++k++k lWe +s+kmr++ f rsp+qCk+kw+nl +r+k ++++e +    +++++p++d+++
  AT2G38250.1  41 QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTRFKGCETMEAET---ARQQFPFYDDMQ 123
                  7********************************************************************84...56679******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004838100IPR001005SANT/Myb domain
CDDcd122032.90E-2240105No hitNo description
PfamPF138378.4E-2141124No hitNo description
PROSITE profilePS500907.6314298IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009029anatomystamen
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDGHQHHHLH QLQYLNKHHL HTQSQTPEIA SPVAVGDRFP QWSVEETKEL IGIRGELDQT  60
FMETKRNKLL WEVISNKMRD KSFPRSPEQC KCKWKNLVTR FKGCETMEAE TARQQFPFYD  120
DMQNIFTTRM QRMLWAESEG GGGGTSGAAR KREYSSDEEE ENVNEELVDV SNDPKILNPK  180
KNIAKKRKGG SNSSNSNNGV REVLEEFMRH QVRMESEWRE GWEAREKERA EKEEEWRRKM  240
EELEKERLAM ERMWRDREEQ RRSREEMRAE KRDSLINALL AKLTRDGSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1338119384DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178187PKKNIAKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.283190.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865063460.0
Genevisible267140_at0.0
Expression AtlasAT2G38250-
AtGenExpressAT2G38250-
ATTED-IIAT2G38250-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269|PubMed:15310827}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G38250.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269|PubMed:15310827}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch O80450
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G38250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4535820.0AF453582.1 Arabidopsis thaliana GT-1 like transcription factor (GT1L) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181360.10.0trihelix transcription factor GT-3b
SwissprotO804500.0TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLD7LLG41e-157D7LLG4_ARALL; Predicted protein
STRINGAT2G38250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
MalvidsOGEM22152870
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ayadi M,Delaporte V,Li YF,Zhou DX
    Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis.
    FEBS Lett., 2004. 562(1-3): p. 147-54
    [PMID:15044016]
  3. Park HC, et al.
    Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor.
    Plant Physiol., 2004. 135(4): p. 2150-61
    [PMID:15310827]
  4. Pendle AF, et al.
    Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions.
    Mol. Biol. Cell, 2005. 16(1): p. 260-9
    [PMID:15496452]
  5. Vanderauwera S, et al.
    Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis.
    Plant Physiol., 2005. 139(2): p. 806-21
    [PMID:16183842]
  6. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  7. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  8. van de Mortel JE, et al.
    Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens.
    Plant Physiol., 2006. 142(3): p. 1127-47
    [PMID:16998091]
  9. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  10. B
    Purification of a plant mediator from Arabidopsis thaliana identifies PFT1 as the Med25 subunit.
    Mol. Cell, 2007. 26(5): p. 717-29
    [PMID:17560376]
  11. Barakat A,Wall PK,Diloreto S,Depamphilis CW,Carlson JE
    Conservation and divergence of microRNAs in Populus.
    BMC Genomics, 2007. 8: p. 481
    [PMID:18166134]
  12. Gandia-Herrero F, et al.
    Detoxification of the explosive 2,4,6-trinitrotoluene in Arabidopsis: discovery of bifunctional O- and C-glucosyltransferases.
    Plant J., 2008. 56(6): p. 963-74
    [PMID:18702669]
  13. Inz
    A subcellular localization compendium of hydrogen peroxide-induced proteins.
    Plant Cell Environ., 2012. 35(2): p. 308-20
    [PMID:21443605]
  14. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]