PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G38090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 298aa    MW: 33250.7 Da    PI: 5.2396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G38090.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.41.8e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + + ++   +W+++a++++ g+t  +++  ++ 
      AT2G38090.1 28 KWTAEENKKFENALAFYDKDtpdRWSRVAAMLP-GKTVGDVIKQYRE 73
                     8********************************.******9999986 PP

2Myb_DNA-binding48.61.9e-15142186347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
      AT2G38090.1 142 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 186
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-52374IPR009057Homeodomain-like
PROSITE profilePS512938.9862479IPR017884SANT domain
SMARTSM007171.5E-102577IPR001005SANT/Myb domain
SuperFamilySSF466891.17E-112781IPR009057Homeodomain-like
CDDcd001673.96E-82874No hitNo description
PfamPF002499.8E-82873IPR001005SANT/Myb domain
PROSITE profilePS5129421.845135191IPR017930Myb domain
SuperFamilySSF466891.66E-17137190IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-18138190IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.7E-13139186IPR009057Homeodomain-like
SMARTSM007178.7E-14139189IPR001005SANT/Myb domain
PfamPF002497.8E-13142186IPR001005SANT/Myb domain
CDDcd001671.76E-11142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNRGIEVMSP ATYLETSNWL FQENRGTKWT AEENKKFENA LAFYDKDTPD RWSRVAAMLP  60
GKTVGDVIKQ YRELEEDVSD IEAGLIPIPG YASDSFTLDW GGYDGASGNN GFNMNGYYFS  120
AAGGKRGSAA RTAEHERKKG VPWTEEEHRQ FLMGLKKYGK GDWRNIARNF VTTRTPTQVA  180
SHAQKYFIRQ VNGGKDKRRS SIHDITTVNI PDSPDAAAAD NATANAPCSP PSVGGNQRET  240
SEWEGQTLYD ETAAAFYNQN AFSETLLGMS STPYMAKLQE QSFLNASQFE SYNAYLQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-172693875RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.468190.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425697210.0
Genevisible267141_at0.0
Expression AtlasAT2G38090-
AtGenExpressAT2G38090-
ATTED-IIAT2G38090-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G38090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G38090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0061220.0BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds.
GenBankAY5195290.0AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds.
GenBankAK1181350.0AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181344.20.0Duplicated homeodomain-like superfamily protein
SwissprotQ8S9H74e-97DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ8GXN70.0Q8GXN7_ARATH; Duplicated homeodomain-like superfamily protein
STRINGAT2G38090.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27517122
MalvidsOGEM122827100
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  3. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  4. Baxter CJ, et al.
    The metabolic response of heterotrophic Arabidopsis cells to oxidative stress.
    Plant Physiol., 2007. 143(1): p. 312-25
    [PMID:17122072]
  5. Panjabi P, et al.
    Comparative mapping of Brassica juncea and Arabidopsis thaliana using Intron Polymorphism (IP) markers: homoeologous relationships, diversification and evolution of the A, B and C Brassica genomes.
    BMC Genomics, 2008. 9: p. 113
    [PMID:18315867]
  6. Machemer K, et al.
    Interplay of MYB factors in differential cell expansion, and consequences for tomato fruit development.
    Plant J., 2011. 68(2): p. 337-50
    [PMID:21707804]