PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G37650.1
Common NameF13M22.15, SCL9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 718aa    MW: 80914.6 Da    PI: 6.3256
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G37650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3759.3e-1153447131374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+av+++d ++a +lL++++ +++p gd +qRla++f+++L+arla+++s++yk + +++ s    + +l+a++lf  ++P+ k+s++++
  AT2G37650.1 344 LRSLLIHCAQAVAADDRRCAGQLLKQIRLHSTPFGDGNQRLAHCFANGLEARLAGTGSQIYKGIVSKPRS---AAAVLKAHQLFLACCPFRKLSYFIT 438
                  689***************************************************************9999...999********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++I + v +++rvH+iDf+i +G+QWp+L++ ++    g+p++RiTg++ p++g   ++++eetg+rLa +A+ +gvpfe+++ +ak++++++le+L
  AT2G37650.1 439 NKTIRDLVGNSQRVHVIDFGILYGFQWPTLIHRFSM--YGSPKVRITGIEFPQPGfrPAQRVEETGQRLAAYAKLFGVPFEYKA-IAKKWDAIQLEDL 533
                  ***********************************9..8***************9*****************************.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++++E ++Vn+ ++ ++l+desv++es+rd+vL+l+ +++P+++v+   +  +n++ F++rf eal ++s++fd+le+ +pre+eer+++E e++gr
  AT2G37650.1 534 DIDRDEITVVNCLYRAENLHDESVKVESCRDTVLNLIGKINPDLFVFGIVNGAYNAPFFVTRFREALFHFSSIFDMLETIVPREDEERMFLEMEVFGR 631
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  e+ nv+aceg er+er et+++W+ r +++G+ +vp++ +++k+  + +++++ + + +++++ +l++gWk+r+++++S+W+
  AT2G37650.1 632 EALNVIACEGWERVERPETYKQWHVRAMRSGLVQVPFDPSIMKTSLHKVHTFYHKDFVIDQDNRWLLQGWKGRTVMALSVWK 713
                  *****************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.453318693IPR005202Transcription factor GRAS
PfamPF035143.2E-112344713IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MITEPSLTGI SGMVNRNRLS GLPDQPSSHS FTPVTLYDGF NYNLSSDHIN TVVAAPENSV  60
FIREEEEEED PADDFDFSDA VLGYISQMLN EEDMDDKVCM LQESLDLEAA ERSLYEAIGK  120
KYPPSPERNL AFAERNSENL DRVVPGNYTG GDCIGFGNGG IKPLSSGFTL DFRNPQSCSS  180
ILSVPQSNGL ITIYGDGIDE SSKNNRENHQ SVWLFRREIE EANRFNPEEN ELIVNFREEN  240
CVSKARKNSS RDEICVEEER SSKLPAVFGE DILRSDVVDK ILVHVPGGES MKEFNALRDV  300
LKKGVEKKKA SDAQGGKRRA RGRGRGRGRG GGGGQNGKKE VVDLRSLLIH CAQAVAADDR  360
RCAGQLLKQI RLHSTPFGDG NQRLAHCFAN GLEARLAGTG SQIYKGIVSK PRSAAAVLKA  420
HQLFLACCPF RKLSYFITNK TIRDLVGNSQ RVHVIDFGIL YGFQWPTLIH RFSMYGSPKV  480
RITGIEFPQP GFRPAQRVEE TGQRLAAYAK LFGVPFEYKA IAKKWDAIQL EDLDIDRDEI  540
TVVNCLYRAE NLHDESVKVE SCRDTVLNLI GKINPDLFVF GIVNGAYNAP FFVTRFREAL  600
FHFSSIFDML ETIVPREDEE RMFLEMEVFG REALNVIACE GWERVERPET YKQWHVRAMR  660
SGLVQVPFDP SIMKTSLHKV HTFYHKDFVI DQDNRWLLQG WKGRTVMALS VWKPESKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-373487138375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1318328RARGRGRGRGR
2320329RGRGRGRGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.664110.0flower| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306872110.0
Genevisible267159_at0.0
Expression AtlasAT2G37650-
AtGenExpressAT2G37650-
ATTED-IIAT2G37650-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, leaves and flowers, and in the elongation zone in root. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G37650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G37650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0046840.0AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181301.10.0GRAS family transcription factor
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLR0HVC00.0R0HVC0_9BRAS; Uncharacterized protein
STRINGAT2G37650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MalvidsOGEM35827189
Publications ? help Back to Top
  1. Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
    The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes.
    Plant J., 1999. 18(1): p. 111-9
    [PMID:10341448]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Menges M,Hennig L,Gruissem W,Murray JA
    Cell cycle-regulated gene expression in Arabidopsis.
    J. Biol. Chem., 2002. 277(44): p. 41987-2002
    [PMID:12169696]
  4. Folta KM,Pontin MA,Karlin-Neumann G,Bottini R,Spalding EP
    Genomic and physiological studies of early cryptochrome 1 action demonstrate roles for auxin and gibberellin in the control of hypocotyl growth by blue light.
    Plant J., 2003. 36(2): p. 203-14
    [PMID:14535885]
  5. Bolle C
    The role of GRAS proteins in plant signal transduction and development.
    Planta, 2004. 218(5): p. 683-92
    [PMID:14760535]
  6. Tian C,Wan P,Sun S,Li J,Chen M
    Genome-wide analysis of the GRAS gene family in rice and Arabidopsis.
    Plant Mol. Biol., 2004. 54(4): p. 519-32
    [PMID:15316287]
  7. Gao MJ,Parkin I,Lydiate D,Hannoufa A
    An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase.
    Plant Mol. Biol., 2004. 55(3): p. 417-31
    [PMID:15604690]
  8. Lee MH, et al.
    Large-scale analysis of the GRAS gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(6): p. 659-70
    [PMID:18500650]
  9. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]