PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G37630.1
Common NameAS1, ATMYB91, ATPHAN, F13M22.13, MYB91, PHAN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 367aa    MW: 42243.1 Da    PI: 9.5547
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G37630.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.1e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW+ eEd ll  +v+q+G++ W++++++m+  ++R +k+c +rw +yl
      AT2G37630.1  4 RQRWSGEEDALLRAYVRQFGPREWHLVSERMNkpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.31.3e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
      AT2G37630.1  59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.469153IPR017930Myb domain
SMARTSM007171.7E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.28E-21498IPR009057Homeodomain-like
CDDcd001679.17E-8653No hitNo description
Gene3DG3DSA:1.10.10.608.2E-20660IPR009057Homeodomain-like
PfamPF139213.8E-13767No hitNo description
PROSITE profilePS5129423.24854108IPR017930Myb domain
SMARTSM007173.2E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1561102IPR009057Homeodomain-like
CDDcd001677.81E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009908Biological Processflower development
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0030154Biological Processcell differentiation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005022anatomyovary wall
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025272anatomyovary replum
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MKERQRWSGE EDALLRAYVR QFGPREWHLV SERMNKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKESNKRVEP  120
IDESKYDRIL ESFAEKLVKE RSNVVPAAAA AATVVMANSN GGFLHSEQQV QPPNPVIPPW  180
LATSNNGNNV VARPPSVTLT LSPSTVAAAA PQPPIPWLQQ QQPERAENGP GGLVLGSMMP  240
SCSGSSESVF LSELVECCRE LEEGHRAWAD HKKEAAWRLR RLELQLESEK TCRQREKMEE  300
IEAKMKALRE EQKNAMEKIE GEYREQLVGL RRDAEAKDQK LADQWTSRHI RLTKFLEQQM  360
GCRLDRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-15792789MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-15792789C-Myb DNA-Binding Domain
1msf_C3e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.115770.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453607230.0
Genevisible267157_at0.0
Expression AtlasAT2G37630-
AtGenExpressAT2G37630-
ATTED-IIAT2G37630-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Preferential expression in young and immature plant tissues. In embryos, expressed from the late globular stage onwards. After germination, detected in leaf founder cells and on flowering, in primordia of all floral organs.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers, siliques and in lateral organ promordia (PubMed:17559509). Found in the inner domain between the adaxial and abaxial domains of leaves (PubMed:17559509). Expressed in the phloem tissues of leaves, cotyledons, hypocotyls, and roots (PubMed:21950734). {ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:21950734}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a MYB-domain protein involved in specification of the leaf proximodistal axis. Mutation results in lobed and dissected leaves with a characteristic asymmetry. Homologous to the Antirrhinum PHANTASTICA (PHAN) and maize ROUGH SHEATH2 (RS2) genes Asymmetric placement of auxin response at the distal leaf tip precedes visible asymmetric leaf growth. Acts alongside AXR1 to exclude BP expression in leaves and with PIN1 to repress BP and promote lateral organ growth. Interacts physically with AS2 to form a complex that binds to the BP promoter and silences BP. Also functions as a regulator of the plant immune response.
UniProtTranscription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). {ECO:0000269|PubMed:11076771, ECO:0000269|PubMed:11140682, ECO:0000269|PubMed:11882937, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976}.
Function -- GeneRIF ? help Back to Top
  1. Our data suggest that RS2/AS1 and HIRA mediate the epigenetic silencing of knox genes, possibly by modulating chromatin structure.
    [PMID: 16243907]
  2. RDR6, SGS3 and AGO7 act in the same pathway, which genetically interacts with the AS1-AS2 pathway for leaf development.
    [PMID: 16699177]
  3. AS1 patterns the Arabidopsis gynoecium by repressing BP.
    [PMID: 17592013]
  4. function of AS1 in responses to phytopathogens is independent of its AS2-associated role in development
    [PMID: 18003921]
  5. A previously unrecognized fundamental regulation by which AS1, AS2, and JAG act to define sepal and petal from their boundaries is reported.
    [PMID: 18156293]
  6. AS1 and AS2 form a repressor complex that binds directly to the regulatory motifs CWGTTD and KMKTTGAHW present at two sites in the promoters of the KNOX genes BREVIPEDICELLUS (BP) and KNAT2.
    [PMID: 18203921]
  7. results of studying new alleles of AS1 and AS2 support their role in control of class I KNOX genes and auxin transport.
    [PMID: 18409376]
  8. AS1, AS2 and the AS1-AS2 protein complex may have distinct functions, which are all required for normal plant development.
    [PMID: 18713400]
  9. Results revealed that the reduction in leaf size and late flowering were caused by the repression, by KNOX genes, of a gibberellin (GA) pathway in as1 and as2 plants.
    [PMID: 19891706]
  10. Data show that TCP3 directly activates the expression of genes for miR164, ASYMMETRIC LEAVES1 (AS1), INDOLE-3-ACETIC ACID3/SHORT HYPOCOTYL2 (IAA3/SHY2), and SMALL AUXIN UP RNA (SAUR) proteins.
    [PMID: 21119060]
  11. CONSTANS (CO) forms a functional complex with ASYMMETRIC LEAVES 1 (AS1) to regulate FLOWERING LOCUS T (FT) expression and that AS1 plays different roles in two regulatory pathways, both of which concomitantly regulate the precise timing of flowering.
    [PMID: 21950734]
  12. AS1 transcriptional control of meristem cell-specific genes is inhibited by Calmodulin.
    [PMID: 22554014]
  13. In combination with mutations in the MYB domain transcription factor gene ASYMMETRIC LEAVES1 (AS1), partial loss of EMBRYO DEFECTIVE DEVELOPMENT1 (EDD1) function results in leaves with reduced adaxial fate.
    [PMID: 22791832]
  14. The JLO and AS2 proteins interact molecularly and form multimeric complexes with AS1 to suppress KNOX expression. AS2 together with JLO regulate auxin transport in seedling roots.
    [PMID: 22822207]
  15. Taken together, these data indicate that HDA6 is a part of the AS1 repressor complex to regulate the KNOX expression in leaf development.
    [PMID: 23271976]
  16. Negative transcriptional, post-transcriptional and epigenetic regulation of ARF3 by AS1-AS2 is important for stabilizing early leaf partitioning into abaxial and adaxial domains.
    [PMID: 23571218]
  17. critical for the proper placement of the floral organ abscission zones, and influences the timing of organ shedding
    [PMID: 25038814]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G37630.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269|PubMed:16166385, ECO:0000269|PubMed:21950734}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G53230 (A), AT1G55580 (A), AT1G62360 (R), AT4G00220 (R), AT5G23000 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G23380(R), AT1G32240(R), AT1G70510(R), AT2G26580(R), AT2G33860(R), AT2G34710(A), AT2G45190(R), AT3G15170(R), AT4G08150(R), AT5G03680(R), AT5G53950(R), AT5G63090(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, gibberellin, Gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G37630, AT4G36870, AT5G15840, AT5G63090, AT1G65620
IntActSearch O80931
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G37630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759960.0AF175996.1 Arabidopsis thaliana putative transcription factor (MYB91) mRNA, complete cds.
GenBankAC0046840.0AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankBT0260270.0BT026027.1 Arabidopsis thaliana At2g37630 mRNA, complete cds.
GenBankAY5195780.0AY519578.1 Arabidopsis thaliana MYB transcription factor (At2g37630) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181299.10.0transcription factor AS1
SwissprotO809310.0AS1_ARATH; Transcription factor AS1
TrEMBLD7LJV50.0D7LJV5_ARALL; Putative uncharacterized protein
TrEMBLD7LJW10.0D7LJW1_ARALL; Putative uncharacterized protein
STRINGAT2G37630.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP50961421
MalvidsOGEM61862740
Publications ? help Back to Top
  1. Timmermans MC,Hudson A,Becraft PW,Nelson T
    ROUGH SHEATH2: a Myb protein that represses knox homeobox genes in maize lateral organ primordia.
    Science, 1999. 284(5411): p. 151-3
    [PMID:10102816]
  2. Ori N,Eshed Y,Chuck G,Bowman JL,Hake S
    Mechanisms that control knox gene expression in the Arabidopsis shoot.
    Development, 2000. 127(24): p. 5523-32
    [PMID:11076771]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Byrne ME, et al.
    Asymmetric leaves1 mediates leaf patterning and stem cell function in Arabidopsis.
    Nature, 2000 Dec 21-28. 408(6815): p. 967-71
    [PMID:11140682]
  5. Tsiantis M
    Control of shoot cell fate: beyond homeoboxes.
    Plant Cell, 2001. 13(4): p. 733-8
    [PMID:11283332]
  6. J
    Apical-basal pattern formation in Arabidopsis embryogenesis.
    EMBO J., 2001. 20(14): p. 3609-16
    [PMID:11447101]
  7. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  8. Sun Y,Zhou Q,Zhang W,Fu Y,Huang H
    ASYMMETRIC LEAVES1, an Arabidopsis gene that is involved in the control of cell differentiation in leaves.
    Planta, 2002. 214(5): p. 694-702
    [PMID:11882937]
  9. Venglat SP, et al.
    The homeobox gene BREVIPEDICELLUS is a key regulator of inflorescence architecture in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(7): p. 4730-5
    [PMID:11917137]
  10. Byrne ME,Simorowski J,Martienssen RA
    ASYMMETRIC LEAVES1 reveals knox gene redundancy in Arabidopsis.
    Development, 2002. 129(8): p. 1957-65
    [PMID:11934861]
  11. Golz JF,Hudson A
    Signalling in plant lateral organ development.
    Plant Cell, 2002. 14 Suppl: p. S277-88
    [PMID:12045283]
  12. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  13. Barley R,Waites R
    Plant meristems: the interplay of KNOX and gibberellins.
    Curr. Biol., 2002. 12(20): p. R696-8
    [PMID:12401187]
  14. Micol JL,Hake S
    The development of plant leaves.
    Plant Physiol., 2003. 131(2): p. 389-94
    [PMID:12586863]
  15. Theodoris G,Inada N,Freeling M
    Conservation and molecular dissection of ROUGH SHEATH2 and ASYMMETRIC LEAVES1 function in leaf development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(11): p. 6837-42
    [PMID:12750468]
  16. Xu L, et al.
    Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.
    Development, 2003. 130(17): p. 4097-107
    [PMID:12874130]
  17. Kim M,McCormick S,Timmermans M,Sinha N
    The expression domain of PHANTASTICA determines leaflet placement in compound leaves.
    Nature, 2003. 424(6947): p. 438-43
    [PMID:12879073]
  18. Lin WC,Shuai B,Springer PS
    The Arabidopsis LATERAL ORGAN BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression of KNOX gene expression and in adaxial-abaxial patterning.
    Plant Cell, 2003. 15(10): p. 2241-52
    [PMID:14508003]
  19. Hibara K,Takada S,Tasaka M
    CUC1 gene activates the expression of SAM-related genes to induce adventitious shoot formation.
    Plant J., 2003. 36(5): p. 687-96
    [PMID:14617069]
  20. Katz A,Oliva M,Mosquna A,Hakim O,Ohad N
    FIE and CURLY LEAF polycomb proteins interact in the regulation of homeobox gene expression during sporophyte development.
    Plant J., 2004. 37(5): p. 707-19
    [PMID:14871310]
  21. McHale NA,Koning RE
    PHANTASTICA regulates development of the adaxial mesophyll in Nicotiana leaves.
    Plant Cell, 2004. 16(5): p. 1251-62
    [PMID:15084717]
  22. Mallory AC,Dugas DV,Bartel DP,Bartel B
    MicroRNA regulation of NAC-domain targets is required for proper formation and separation of adjacent embryonic, vegetative, and floral organs.
    Curr. Biol., 2004. 14(12): p. 1035-46
    [PMID:15202996]
  23. Engstrom EM,Izhaki A,Bowman JL
    Promoter bashing, microRNAs, and Knox genes. New insights, regulators, and targets-of-regulation in the establishment of lateral organ polarity in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 685-94
    [PMID:15208415]
  24. Schrader J, et al.
    A high-resolution transcript profile across the wood-forming meristem of poplar identifies potential regulators of cambial stem cell identity.
    Plant Cell, 2004. 16(9): p. 2278-92
    [PMID:15316113]
  25. Zgurski JM,Sharma R,Bolokoski DA,Schultz EA
    Asymmetric auxin response precedes asymmetric growth and differentiation of asymmetric leaf1 and asymmetric leaf2 Arabidopsis leaves.
    Plant Cell, 2005. 17(1): p. 77-91
    [PMID:15608337]
  26. Tattersall AD, et al.
    The mutant crispa reveals multiple roles for PHANTASTICA in pea compound leaf development.
    Plant Cell, 2005. 17(4): p. 1046-60
    [PMID:15749758]
  27. Kwon CS,Chen C,Wagner D
    WUSCHEL is a primary target for transcriptional regulation by SPLAYED in dynamic control of stem cell fate in Arabidopsis.
    Genes Dev., 2005. 19(8): p. 992-1003
    [PMID:15833920]
  28. Kidner CA,Martienssen RA
    The role of ARGONAUTE1 (AGO1) in meristem formation and identity.
    Dev. Biol., 2005. 280(2): p. 504-17
    [PMID:15882589]
  29. Li H, et al.
    The Putative RNA-dependent RNA polymerase RDR6 acts synergistically with ASYMMETRIC LEAVES1 and 2 to repress BREVIPEDICELLUS and MicroRNA165/166 in Arabidopsis leaf development.
    Plant Cell, 2005. 17(8): p. 2157-71
    [PMID:16006579]
  30. Chua YL,Channeli
    The bromodomain protein GTE6 controls leaf development in Arabidopsis by histone acetylation at ASYMMETRIC LEAVES1.
    Genes Dev., 2005. 19(18): p. 2245-54
    [PMID:16166385]
  31. Phelps-Durr TL,Thomas J,Vahab P,Timmermans MC
    Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis.
    Plant Cell, 2005. 17(11): p. 2886-98
    [PMID:16243907]
  32. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  33. Keller T,Abbott J,Moritz T,Doerner P
    Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development.
    Plant Cell, 2006. 18(3): p. 598-611
    [PMID:16473968]
  34. Garcia D,Collier SA,Byrne ME,Martienssen RA
    Specification of leaf polarity in Arabidopsis via the trans-acting siRNA pathway.
    Curr. Biol., 2006. 16(9): p. 933-8
    [PMID:16682355]
  35. Xu L, et al.
    Genetic interaction between the AS1-AS2 and RDR6-SGS3-AGO7 pathways for leaf morphogenesis.
    Plant Cell Physiol., 2006. 47(7): p. 853-63
    [PMID:16699177]
  36. Hay A,Barkoulas M,Tsiantis M
    ASYMMETRIC LEAVES1 and auxin activities converge to repress BREVIPEDICELLUS expression and promote leaf development in Arabidopsis.
    Development, 2006. 133(20): p. 3955-61
    [PMID:16971475]
  37. Huang W, et al.
    The proteolytic function of the Arabidopsis 26S proteasome is required for specifying leaf adaxial identity.
    Plant Cell, 2006. 18(10): p. 2479-92
    [PMID:17028202]
  38. Okushima Y,Fukaki H,Onoda M,Theologis A,Tasaka M
    ARF7 and ARF19 regulate lateral root formation via direct activation of LBD/ASL genes in Arabidopsis.
    Plant Cell, 2007. 19(1): p. 118-30
    [PMID:17259263]
  39. Ueno Y, et al.
    Histone deacetylases and ASYMMETRIC LEAVES2 are involved in the establishment of polarity in leaves of Arabidopsis.
    Plant Cell, 2007. 19(2): p. 445-57
    [PMID:17293570]
  40. Fu Y, et al.
    Genetic interactions between leaf polarity-controlling genes and ASYMMETRIC LEAVES1 and 2 in Arabidopsis leaf patterning.
    Plant Cell Physiol., 2007. 48(5): p. 724-35
    [PMID:17395603]
  41. Borghi L,Bureau M,Simon R
    Arabidopsis JAGGED LATERAL ORGANS is expressed in boundaries and coordinates KNOX and PIN activity.
    Plant Cell, 2007. 19(6): p. 1795-808
    [PMID:17557810]
  42. Iwakawa H, et al.
    Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves.
    Plant J., 2007. 51(2): p. 173-84
    [PMID:17559509]
  43. Alonso-Cantabrana H, et al.
    Common regulatory networks in leaf and fruit patterning revealed by mutations in the Arabidopsis ASYMMETRIC LEAVES1 gene.
    Development, 2007. 134(14): p. 2663-71
    [PMID:17592013]
  44. Ha CM,Jun JH,Nam HG,Fletcher JC
    BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.
    Plant Cell, 2007. 19(6): p. 1809-25
    [PMID:17601823]
  45. Lin Z, et al.
    AtCDC5 regulates the G2 to M transition of the cell cycle and is critical for the function of Arabidopsis shoot apical meristem.
    Cell Res., 2007. 17(9): p. 815-28
    [PMID:17768399]
  46. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  47. Husbands A,Bell EM,Shuai B,Smith HM,Springer PS
    LATERAL ORGAN BOUNDARIES defines a new family of DNA-binding transcription factors and can interact with specific bHLH proteins.
    Nucleic Acids Res., 2007. 35(19): p. 6663-71
    [PMID:17913740]
  48. Nurmberg PL, et al.
    The developmental selector AS1 is an evolutionarily conserved regulator of the plant immune response.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(47): p. 18795-800
    [PMID:18003921]
  49. Xu B, et al.
    Arabidopsis genes AS1, AS2, and JAG negatively regulate boundary-specifying genes to promote sepal and petal development.
    Plant Physiol., 2008. 146(2): p. 566-75
    [PMID:18156293]
  50. Guo M,Thomas J,Collins G,Timmermans MC
    Direct repression of KNOX loci by the ASYMMETRIC LEAVES1 complex of Arabidopsis.
    Plant Cell, 2008. 20(1): p. 48-58
    [PMID:18203921]
  51. Yao Y,Ling Q,Wang H,Huang H
    Ribosomal proteins promote leaf adaxial identity.
    Development, 2008. 135(7): p. 1325-34
    [PMID:18305007]
  52. Vu KhCh,Ondar UN,Soldatova OP
    [Expression of new mutant alleles of AS1 and AS2 genes controlling leaf morphogenesis in Arabidopsis thaliana]
    Ontogenez, 2008 Jan-Feb. 39(1): p. 8-14
    [PMID:18409376]
  53. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  54. Zhu Y, et al.
    Subcellular localizations of AS1 and AS2 suggest their common and distinct roles in plant development.
    J Integr Plant Biol, 2008. 50(7): p. 897-905
    [PMID:18713400]
  55. Yang JY, et al.
    betaC1, the pathogenicity factor of TYLCCNV, interacts with AS1 to alter leaf development and suppress selective jasmonic acid responses.
    Genes Dev., 2008. 22(18): p. 2564-77
    [PMID:18794352]
  56. Morimoto R,Nishioka E,Murai K,Takumi S
    Functional conservation of wheat orthologs of maize rough sheath1 and rough sheath2 genes.
    Plant Mol. Biol., 2009. 69(3): p. 273-85
    [PMID:18974935]
  57. Soyano T,Thitamadee S,Machida Y,Chua NH
    ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.
    Plant Cell, 2008. 20(12): p. 3359-73
    [PMID:19088331]
  58. Micol JL
    Leaf development: time to turn over a new leaf?
    Curr. Opin. Plant Biol., 2009. 12(1): p. 9-16
    [PMID:19109050]
  59. Takahashi H, et al.
    Knowledge-based fuzzy adaptive resonance theory and its application to the analysis of gene expression in plants.
    J. Biosci. Bioeng., 2008. 106(6): p. 587-93
    [PMID:19134556]
  60. Liu Z, et al.
    Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana.
    Plant J., 2009. 59(1): p. 27-38
    [PMID:19228338]
  61. Jaspers P, et al.
    Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.
    Plant J., 2009. 60(2): p. 268-79
    [PMID:19548978]
  62. Graciet E, et al.
    The N-end rule pathway controls multiple functions during Arabidopsis shoot and leaf development.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(32): p. 13618-23
    [PMID:19620738]
  63. Ikezaki M, et al.
    Genetic networks regulated by ASYMMETRIC LEAVES1 (AS1) and AS2 in leaf development in Arabidopsis thaliana: KNOX genes control five morphological events.
    Plant J., 2010. 61(1): p. 70-82
    [PMID:19891706]
  64. Tabata R, et al.
    Arabidopsis auxin response factor6 and 8 regulate jasmonic acid biosynthesis and floral organ development via repression of class 1 KNOX genes.
    Plant Cell Physiol., 2010. 51(1): p. 164-75
    [PMID:20007966]
  65. Yun KY, et al.
    Transcriptional regulatory network triggered by oxidative signals configures the early response mechanisms of japonica rice to chilling stress.
    BMC Plant Biol., 2010. 10: p. 16
    [PMID:20100339]
  66. P
    A role for AUXIN RESISTANT3 in the coordination of leaf growth.
    Plant Cell Physiol., 2010. 51(10): p. 1661-73
    [PMID:20739302]
  67. Wang L, et al.
    miR396-targeted AtGRF transcription factors are required for coordination of cell division and differentiation during leaf development in Arabidopsis.
    J. Exp. Bot., 2011. 62(2): p. 761-73
    [PMID:21036927]
  68. Koyama T,Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M
    TCP transcription factors regulate the activities of ASYMMETRIC LEAVES1 and miR164, as well as the auxin response, during differentiation of leaves in Arabidopsis.
    Plant Cell, 2010. 22(11): p. 3574-88
    [PMID:21119060]
  69. Horiguchi G, et al.
    Differential contributions of ribosomal protein genes to Arabidopsis thaliana leaf development.
    Plant J., 2011. 65(5): p. 724-36
    [PMID:21251100]
  70. Song YH,Lee I,Lee SY,Imaizumi T,Hong JC
    CONSTANS and ASYMMETRIC LEAVES 1 complex is involved in the induction of FLOWERING LOCUS T in photoperiodic flowering in Arabidopsis.
    Plant J., 2012. 69(2): p. 332-42
    [PMID:21950734]
  71. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  72. Li Z,Li B,Shen WH,Huang H,Dong A
    TCP transcription factors interact with AS2 in the repression of class-I KNOX genes in Arabidopsis thaliana.
    Plant J., 2012. 71(1): p. 99-107
    [PMID:22380849]
  73. Han HJ, et al.
    The transcriptional repressor activity of ASYMMETRIC LEAVES1 is inhibited by direct interaction with calmodulin in Arabidopsis.
    Plant Cell Environ., 2012. 35(11): p. 1969-82
    [PMID:22554014]
  74. Nakagawa A, et al.
    Berberine enhances defects in the establishment of leaf polarity in asymmetric leaves1 and asymmetric leaves2 of Arabidopsis thaliana.
    Plant Mol. Biol., 2012. 79(6): p. 569-81
    [PMID:22684430]
  75. Moschopoulos A,Derbyshire P,Byrne ME
    The Arabidopsis organelle-localized glycyl-tRNA synthetase encoded by EMBRYO DEFECTIVE DEVELOPMENT1 is required for organ patterning.
    J. Exp. Bot., 2012. 63(14): p. 5233-43
    [PMID:22791832]
  76. Rast MI,Simon R
    Arabidopsis JAGGED LATERAL ORGANS acts with ASYMMETRIC LEAVES2 to coordinate KNOX and PIN expression in shoot and root meristems.
    Plant Cell, 2012. 24(7): p. 2917-33
    [PMID:22822207]
  77. Mecchia MA,Debernardi JM,Rodriguez RE,Schommer C,Palatnik JF
    MicroRNA miR396 and RDR6 synergistically regulate leaf development.
    Mech. Dev., 2013. 130(1): p. 2-13
    [PMID:22889666]
  78. Bonaccorso O,Lee JE,Puah L,Scutt CP,Golz JF
    FILAMENTOUS FLOWER controls lateral organ development by acting as both an activator and a repressor.
    BMC Plant Biol., 2012. 12: p. 176
    [PMID:23025792]
  79. Gonz
    Antagonistic gene activities determine the formation of pattern elements along the mediolateral axis of the Arabidopsis fruit.
    PLoS Genet., 2012. 8(11): p. e1003020
    [PMID:23133401]
  80. Ishibashi N, et al.
    ASYMMETRIC-LEAVES2 and an ortholog of eukaryotic NudC domain proteins repress expression of AUXIN-RESPONSE-FACTOR and class 1 KNOX homeobox genes for development of flat symmetric leaves in Arabidopsis.
    Biol Open, 2012. 1(3): p. 197-207
    [PMID:23213410]
  81. Luo M, et al.
    Histone deacetylase HDA6 is functionally associated with AS1 in repression of KNOX genes in arabidopsis.
    PLoS Genet., 2012. 8(12): p. e1003114
    [PMID:23271976]
  82. Takahashi H, et al.
    Meta-analyses of microarrays of Arabidopsis asymmetric leaves1 (as1), as2 and their modifying mutants reveal a critical role for the ETT pathway in stabilization of adaxial-abaxial patterning and cell division during leaf development.
    Plant Cell Physiol., 2013. 54(3): p. 418-31
    [PMID:23396601]
  83. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  84. Lodha M,Marco CF,Timmermans MC
    The ASYMMETRIC LEAVES complex maintains repression of KNOX homeobox genes via direct recruitment of Polycomb-repressive complex2.
    Genes Dev., 2013. 27(6): p. 596-601
    [PMID:23468429]
  85. Iwasaki M, et al.
    Dual regulation of ETTIN (ARF3) gene expression by AS1-AS2, which maintains the DNA methylation level, is involved in stabilization of leaf adaxial-abaxial partitioning in Arabidopsis.
    Development, 2013. 140(9): p. 1958-69
    [PMID:23571218]
  86. Gubert CM,Christy ME,Ward DL,Groner WD,Liljegren SJ
    ASYMMETRIC LEAVES1 regulates abscission zone placement in Arabidopsis flowers.
    BMC Plant Biol., 2014. 14: p. 195
    [PMID:25038814]
  87. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  88. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]