PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G37590.1
Common NameATDOF2.4, DOF2.4, F13M22.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 330aa    MW: 35330.5 Da    PI: 9.2231
Description DNA binding with one finger 2.4
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G37590.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.2e-3986145362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n++++
  AT2G37590.1  86 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRRTK 145
                  6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3669138IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3288143IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47889143IPR003851Zinc finger, Dof-type
PROSITE patternPS01361091127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000026anatomyprimary root tip
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0000400anatomyphloem mother cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNYNHDGTGA SANGGHVLRP QLQPQQQPQQ QPHPNGSGGG  60
GGGGGGSIRA GSMVDRARQA NVALPEAALK CPRCESTNTK FCYFNNYSLT QPRHFCKTCR  120
RYWTRGGALR NVPVGGGCRR NRRTKSNSNN NNNSTATSNN TSFSSGNAST ISTILSSHYG  180
GNQESILSQI LSPARLMNPT YNHLGDLTSN TKTDNNMSLL NYGGLSQDLR SIHMGASGGS  240
LMSCVDEWRS ASYHQQSSMG GGNLEDSSNP NPSANGFYSF ESPRITSASI SSALASQFSS  300
VKVEDNPYKW VNVNGNCSSW NDLSAFGSSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15666SGGGGGGGGGS
2129142RNVPVGGGCRRNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.501200.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267171_at0.0
Expression AtlasAT2G37590-
AtGenExpressAT2G37590-
ATTED-IIAT2G37590-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. AtDof2.4 and AtDof5.8 might function in the early but different processes for vascular development
    [PMID: 17583520]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G37590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G37590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0300140.0BT030014.1 Arabidopsis thaliana At2g37590 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181295.10.0Dof zinc finger protein DOF2.4
SwissprotO809280.0DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLC0SV780.0C0SV78_ARATH; Putative uncharacterized protein At2g37590 (Fragment)
STRINGAT2G37590.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MalvidsOGEM113541732
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  5. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  6. Konishi M,Yanagisawa S
    Sequential activation of two Dof transcription factor gene promoters during vascular development in Arabidopsis thaliana.
    Plant Physiol. Biochem., 2007. 45(8): p. 623-9
    [PMID:17583520]
  7. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  8. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  9. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]