Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | WRKY | 101.3 | 5.9e-32 | 84 | 140 | 3 | 60 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers +++v ei+Y+geHnh+k
AT2G37260.2 84 DGYNWRKYGQKQVKGSECPRSYYKCTHPKCPVKKKVERSV-EGQVSEIVYQGEHNHSK 140
9***************************************.***************85 PP
|
2 | WRKY | 103.5 | 1.2e-32 | 267 | 324 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dg++WrKYGqK+v g+ +prsYYrCtsa+C+++k+ver+++dp+++++tYeg+Hnh+
AT2G37260.2 267 EDGFRWRKYGQKVVGGNAYPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHH 324
8********************************************************7 PP
|
Publications
? help Back to Top |
- Eulgem T,Rushton PJ,Robatzek S,Somssich IE
The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Johnson CS,Kolevski B,Smyth DR
TRANSPARENT TESTA GLABRA2, a trichome and seed coat development gene of Arabidopsis, encodes a WRKY transcription factor. Plant Cell, 2002. 14(6): p. 1359-75 [PMID:12084832] - Marles MA,Ray H,Gruber MY
New perspectives on proanthocyanidin biochemistry and molecular regulation. Phytochemistry, 2003. 64(2): p. 367-83 [PMID:12943753] - Debeaujon I, et al.
Proanthocyanidin-accumulating cells in Arabidopsis testa: regulation of differentiation and role in seed development. Plant Cell, 2003. 15(11): p. 2514-31 [PMID:14555692] - Western TL, et al.
MUCILAGE-MODIFIED4 encodes a putative pectin biosynthetic enzyme developmentally regulated by APETALA2, TRANSPARENT TESTA GLABRA1, and GLABRA2 in the Arabidopsis seed coat. Plant Physiol., 2004. 134(1): p. 296-306 [PMID:14701918] - Garcia D,Fitz Gerald JN,Berger F
Maternal control of integument cell elongation and zygotic control of endosperm growth are coordinated to determine seed size in Arabidopsis. Plant Cell, 2005. 17(1): p. 52-60 [PMID:15598800] - Ishida T, et al.
Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation. Plant Cell, 2007. 19(8): p. 2531-43 [PMID:17766401] - Zhao M,Morohashi K,Hatlestad G,Grotewold E,Lloyd A
The TTG1-bHLH-MYB complex controls trichome cell fate and patterning through direct targeting of regulatory loci. Development, 2008. 135(11): p. 1991-9 [PMID:18434419] - Gonzalez A,Mendenhall J,Huo Y,Lloyd A
TTG1 complex MYBs, MYB5 and TT2, control outer seed coat differentiation. Dev. Biol., 2009. 325(2): p. 412-21 [PMID:18992236] - Dilkes BP, et al.
The maternally expressed WRKY transcription factor TTG2 controls lethality in interploidy crosses of Arabidopsis. PLoS Biol., 2008. 6(12): p. 2707-20 [PMID:19071961] - Buer CS,Djordjevic MA
Architectural phenotypes in the transparent testa mutants of Arabidopsis thaliana. J. Exp. Bot., 2009. 60(3): p. 751-63 [PMID:19129166] - Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development. Mol Plant, 2009. 2(4): p. 803-22 [PMID:19626137] - Fang W,Wang Z,Cui R,Li J,Li Y
Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana. Plant J., 2012. 70(6): p. 929-39 [PMID:22251317] - Bruex A, et al.
A gene regulatory network for root epidermis cell differentiation in Arabidopsis. PLoS Genet., 2012. 8(1): p. e1002446 [PMID:22253603] - Li B, et al.
Tobacco TTG2 suppresses resistance to pathogens by sequestering NPR1 from the nucleus. J. Cell. Sci., 2012. 125(Pt 20): p. 4913-22 [PMID:22797922] - Xu W, et al.
Regulation of flavonoid biosynthesis involves an unexpected complex transcriptional regulation of TT8 expression, in Arabidopsis. New Phytol., 2013. 198(1): p. 59-70 [PMID:23398515] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Han Y,Zhang X,Wang W,Wang Y,Ming F
The suppression of WRKY44 by GIGANTEA-miR172 pathway is involved in drought response of Arabidopsis thaliana. PLoS ONE, 2013. 8(11): p. e73541 [PMID:24223111] - Pesch M,Dartan B,Birkenbihl R,Somssich IE,H
Arabidopsis TTG2 regulates TRY expression through enhancement of activator complex-triggered activation. Plant Cell, 2014. 26(10): p. 4067-83 [PMID:25304203] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]
|