PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G36960.2
Common NameT1J8.14, TKI1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 741aa    MW: 82029.5 Da    PI: 6.4086
Description TSL-kinase interacting protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G36960.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-085799347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
      AT2G36960.2 57 AWTHQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 99
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1049104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-552102IPR009057Homeodomain-like
PROSITE profilePS5129313.5253104IPR017884SANT domain
SMARTSM007175.1E-654102IPR001005SANT/Myb domain
CDDcd001671.21E-557100No hitNo description
PfamPF002493.1E-65799IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0016301Molecular Functionkinase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MLKQFTHYCE MQAELIPEGP NGEGRLSNQN SNPNLLSSAS ISITQFPAKK PTRQWAAWTH  60
QEEESFFTAL RQVGKNFEKI TSRVQSKNKD QVRHYYYRLV RRMNKLLGPD LSLDAKNPKD  120
TNAAMLRWWS LLEKYSCKAS KLHLKPRRFK LFIEALEHQL LKDRRKSIRK RTCQGENLSS  180
ASLGNISSHS RERGLDNRPF KLILSDGQNV KKLGPGRAST KHGESLSVNL GDEKEDTAFG  240
RGGRQRRKQG YRKWEKAAID GVSLVADAAE HLERTSIDKD MDDQTGPTRY LTGKSPLSLC  300
SAGDVPLSDA NMQFSAKLKL QLFPIDECTR RSLEMDKHNP HLELTLSNRK KISSVLEHLN  360
RKWGSSSCAT GELLLFPYNA RKETVTCHQR WTHDSFLSAA EVHSMVGSPS VFRLRYGWFV  420
HDASGSIISQ VPTSDPCPSL EDDMNVDRLN EVNMLLTESG PLSVHSTAEQ TTSVEPSQGL  480
VCASGVHDRP ARSRDDYEPA STSITPLEHL SGGNAQSPGE WADSLTNISI GDLLSEVPDD  540
IDSDGVDPPA TEGSHYLLRD VPFTSDSFDA AIAAHILRHQ NKPSAQLPLT SGSSSLWDDE  600
ETRDAFSFQK NRFANSTELA SVASPKGVGR VNGEPSQLVE ASSGDEGSYN PHDDGDPMEE  660
GPADPHTMDS PGKTPCGLAD VYWPDSLGPL DLDIRSSKYT DDLILSESLG GLSRLIATSL  720
DAFQNCSLFG FDNKKDKSNM V
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.270790.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263886_at0.0
Expression AtlasAT2G36960-
AtGenExpressAT2G36960-
ATTED-IIAT2G36960-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Functional Description ? help Back to Top
Source Description
TAIRArabidopsis thaliana myb/SANT domain protein
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G36960.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8LJT8
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G36960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5301600.0AF530160.1 Arabidopsis thaliana myb/SANT domain protein (TKI1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850274.10.0TSL-kinase interacting protein 1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLF4IP390.0F4IP39_ARATH; TSL-kinase interacting protein 1
STRINGAT2G36960.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  2. Ehsan H,Reichheld JP,Durfee T,Roe JL
    TOUSLED kinase activity oscillates during the cell cycle and interacts with chromatin regulators.
    Plant Physiol., 2004. 134(4): p. 1488-99
    [PMID:15047893]
  3. Sottosanto JB,Saranga Y,Blumwald E
    Impact of AtNHX1, a vacuolar Na+/H+ antiporter, upon gene expression during short- and long-term salt stress in Arabidopsis thaliana.
    BMC Plant Biol., 2007. 7: p. 18
    [PMID:17411438]
  4. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  5. Bowen AJ, et al.
    PAH-domain-specific interactions of the Arabidopsis transcription coregulator SIN3-LIKE1 (SNL1) with telomere-binding protein 1 and ALWAYS EARLY2 Myb-DNA binding factors.
    J. Mol. Biol., 2010. 395(5): p. 937-49
    [PMID:19962994]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]