PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G36890.1
Common NameATMYB38, BIT1, MYB38, RAX2, T1J8.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 298aa    MW: 34057.1 Da    PI: 7.1008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G36890.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+d++++ G+g +W + +++ g++R++k+c++rw++yl
      AT2G36890.1 14 RGPWSPEEDAKLKDYIEKQGTGgNWIALPHKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding44.73.1e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd +++ +++  G++ W+ Ia++++ gRt++++k++w++
      AT2G36890.1  69 GDFTEEEDNIIYSLFASIGSR-WSVIAAHLQ-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.148962IPR017930Myb domain
SuperFamilySSF466894.49E-2711109IPR009057Homeodomain-like
SMARTSM007172.6E-111364IPR001005SANT/Myb domain
PfamPF002492.1E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-231569IPR009057Homeodomain-like
CDDcd001671.10E-71662No hitNo description
PROSITE profilePS5129422.96763117IPR017930Myb domain
SMARTSM007179.9E-1367115IPR001005SANT/Myb domain
PfamPF002492.2E-1369111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2470118IPR009057Homeodomain-like
CDDcd001673.27E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0007275Biological Processmulticellular organism development
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009785Biological Processblue light signaling pathway
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDAKLKDYIE KQGTGGNWIA LPHKAGLRRC GKSCRLRWLN  60
YLRPNIRHGD FTEEEDNIIY SLFASIGSRW SVIAAHLQGR TDNDIKNYWN TKLKKKLIAT  120
MAPPPHHHLA IATSSSSASP SSSSHYNMIN SLLPYNPSTN QLLTPHQGIM MTMMGQQQQL  180
FYQEDMGNLV NSPNRNNLIM SHQEDNQEQS TNKGIMLLSD VRSGSSTTST VTRVKMEHRD  240
HDDHHHHHEE DERSMTSVVM EDYGMEEIKQ LISSSCTSSN NSLWFDENKT EDKFMLYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.374910.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263892_at0.0
Expression AtlasAT2G36890-
AtGenExpressAT2G36890-
ATTED-IIAT2G36890-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous, with higher levels in roots, flowers, and shoot tips. Found in all cells of the shoot tips. {ECO:0000269|PubMed:16461581}.
Functional Description ? help Back to Top
Source Description
TAIR"Putative homolog of the Blind gene in tomato. Together with RAX1 and RAX3 belong to the class R2R3 MYB genes; encoded by the Myb-like transcription factor MYB38, regulates axillary meristem formation. "
UniProtTranscription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}.
Function -- GeneRIF ? help Back to Top
  1. rax mutants show new phenotypes that are characterized by defects in lateral bud formation in overlapping zones along the shoot axis. RAX genes are partially redundant in function and allow a fine-tuning of secondary axis formation
    [PMID: 16461581]
  2. The MYB transcription factor Blue Insensitive Trait 1 (BIT1) functions as a positive element in blue light signaling.
    [PMID: 18397371]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G36890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G44575(A), AT5G53950(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, gibberellin, jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SJL7
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G36890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195770.0AY519577.1 Arabidopsis thaliana MYB transcription factor (At2g36890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181226.10.0transcription factor RAX2
SwissprotQ9SJL70.0RAX2_ARATH; Transcription factor RAX2
TrEMBLR0HDJ31e-167R0HDJ3_9BRAS; Uncharacterized protein
STRINGAT2G36890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MalvidsOGEM4282646
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Tian L, et al.
    Reversible histone acetylation and deacetylation mediate genome-wide, promoter-dependent and locus-specific changes in gene expression during plant development.
    Genetics, 2005. 169(1): p. 337-45
    [PMID:15371352]
  4. Müller D,Schmitz G,Theres K
    Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis.
    Plant Cell, 2006. 18(3): p. 586-97
    [PMID:16461581]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Keller T,Abbott J,Moritz T,Doerner P
    Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development.
    Plant Cell, 2006. 18(3): p. 598-611
    [PMID:16473968]
  7. Ehrenreich IM,Stafford PA,Purugganan MD
    The genetic architecture of shoot branching in Arabidopsis thaliana: a comparative assessment of candidate gene associations vs. quantitative trait locus mapping.
    Genetics, 2007. 176(2): p. 1223-36
    [PMID:17435248]
  8. Hong SH, et al.
    CRY1 inhibits COP1-mediated degradation of BIT1, a MYB transcription factor, to activate blue light-dependent gene expression in Arabidopsis.
    Plant J., 2008. 55(3): p. 361-71
    [PMID:18397371]
  9. Liu R, et al.
    Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis.
    J. Biosci., 2010. 35(3): p. 435-50
    [PMID:20826953]
  10. Jeifetz D,David-Schwartz R,Borovsky Y,Paran I
    CaBLIND regulates axillary meristem initiation and transition to flowering in pepper.
    Planta, 2011. 234(6): p. 1227-36
    [PMID:21773792]
  11. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  12. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]