PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G36340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GeBP
Protein Properties Length: 414aa    MW: 47339.2 Da    PI: 4.1127
Description DNA-binding storekeeper protein-related transcriptional regulator
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G36340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573106.22.5e-3359154398
       DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  +++ ws++De+v+L G++d++++t+ s+ +d+da+y+++k+++++k+sk ql++K++++K+Kf+ ++ ++++g++ sf++++d++if+ls +iW++
  AT2G36340.1  59 SKMNWSKNDELVILGGIVDYENETKLSYRSDWDALYRYIKDCVEAKFSKIQLINKVKNMKRKFTYNQGRSNHGEQLSFTNTDDDEIFKLSLIIWDK 154
                  7899******************************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.4E-2361153IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009010anatomyseed
PO:0009066anatomyanther
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MVGTKRVADS IDTNSDDTLT RNREVEVEAM LSRRKQLRTT TTRTTTTRTT PLSLSSSASK  60
MNWSKNDELV ILGGIVDYEN ETKLSYRSDW DALYRYIKDC VEAKFSKIQL INKVKNMKRK  120
FTYNQGRSNH GEQLSFTNTD DDEIFKLSLI IWDKNESEYV SNENIDQAKD VPSGEPETND  180
VPCEEQDDRD VPCEEQERAN IEIDNGVREK LDQAKDVPCV EQESEDVPCV EQERVSIEID  240
NGEKEKLDQT MDCEEQENTD VLCEEKGDKD VPCEEQENKD VPCEEQERVS IEIDNGEEEM  300
SSEEDGVDEV GVMEDTLDSG ISFQGLGKNG VKDKSEEDDV VELGVLQEIF KEDTFFQSLG  360
RYQQKLLLQN LENVGVERRK ELINEWKALF VDEQRLCVKK LTFAAKLANL GVSP
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865058230.0
Expression AtlasAT2G36340-
AtGenExpressAT2G36340-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the apical meristem and young leaf primordia. Detected in the vascular tissues of rosette leaves, in primary and secondary roots and at the base of flowers and siliques. {ECO:0000269|PubMed:18162594}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Involved in stress responses (PubMed:21875893). Plays a repressive role in cell expansion by counteracting the positive role of CPR5 in this process, but does not regulate cell proliferation or endoreduplication (PubMed:21875893). {ECO:0000269|PubMed:21875893}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G36340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G00270, AT5G14280
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G36340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7738630.0AY773863.1 Arabidopsis thaliana clone pENTR221-At2g36340 hypothetical protein (At2g36340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_181175.10.0DNA-binding storekeeper protein-related transcriptional regulator
SwissprotQ9SJM40.0STKLI_ARATH; GLABROUS1 enhancer-binding protein-like 3
TrEMBLA0A178VUJ80.0A0A178VUJ8_ARATH; Uncharacterized protein
STRINGAT2G36340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM124401528
Representative plantOGRP4222523
Publications ? help Back to Top
  1. Curaba J,Herzog M,Vachon G
    GeBP, the first member of a new gene family in Arabidopsis, encodes a nuclear protein with DNA-binding activity and is regulated by KNAT1.
    Plant J., 2003. 33(2): p. 305-17
    [PMID:12535344]
  2. Chevalier F, et al.
    GeBP and GeBP-like proteins are noncanonical leucine-zipper transcription factors that regulate cytokinin response in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1142-54
    [PMID:18162594]
  3. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  4. Khare D, et al.
    Root avoidance of toxic metals requires the GeBP-LIKE 4 transcription factor in Arabidopsis thaliana.
    New Phytol., 2017. 213(3): p. 1257-1273
    [PMID:27768815]
  5. Nietzsche M, et al.
    STOREKEEPER RELATED1/G-Element Binding Protein (STKR1) Interacts with Protein Kinase SnRK1.
    Plant Physiol., 2018. 176(2): p. 1773-1792
    [PMID:29192025]