PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G36270.1
Common NameABI5, AtABI5, BZIP39, DPBF1, F2H17.12, GIA1, NEM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 442aa    MW: 47006.7 Da    PI: 9.3128
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G36270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.3e-15357405553
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk  l el+
  AT2G36270.1 357 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENAQLKHALAELE 405
                  79****************************************9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-16353417IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.748355407IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.56E-11357406No hitNo description
CDDcd147073.93E-24357411No hitNo description
PfamPF001704.0E-13357405IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.7E-15357405No hitNo description
PROSITE patternPS000360360375IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010182Biological Processsugar mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000200anatomymicropylar endosperm
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009089anatomyendosperm
PO:0019018anatomyplant embryo axis
PO:0020030anatomycotyledon
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001040developmental stagedry seed stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007134developmental stagesporophyte vegetative stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
PO:0025374developmental stageseed dormant stage
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MVTRETKLTS EREVESSMAQ ARHNGGGGGE NHPFTSLGRQ SSIYSLTLDE FQHALCENGK  60
NFGSMNMDEF LVSIWNAEEN NNNQQQAAAA AGSHSVPANH NGFNNNNNNG GEGGVGVFSG  120
GSRGNEDANN KRGIANESSL PRQGSLTLPA PLCRKTVDEV WSEIHRGGGS GNGGDSNGRS  180
SSSNGQNNAQ NGGETAARQP TFGEMTLEDF LVKAGVVREH PTNPKPNPNP NQNQNPSSVI  240
PAAAQQQLYG VFQGTGDPSF PGQAMGVGDP SGYAKRTGGG GYQQAPPVQA GVCYGGGVGF  300
GAGGQQMGMV GPLSPVSSDG LGHGQVDNIG GQYGVDMGGL RGRKRVVDGP VEKVVERRQR  360
RMIKNRESAA RSRARKQAYT VELEAELNQL KEENAQLKHA LAELERKRKQ QYFESLKSRA  420
QPKLPKSNGR LRTLMRNPSC PL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.141140.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453606710.0
Genevisible263907_at0.0
Expression AtlasAT2G36270-
AtGenExpressAT2G36270-
ATTED-IIAT2G36270-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:12084834}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:10760247, ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the basic leucine zipper transcription factor family, involved in ABA signalling during seed maturation and germination. The Arabidopsis abscisic acid (ABA)-insensitive abi5 mutants have pleiotropic defects in ABA response, including decreased sensitivity to ABA inhibition of germination and altered expression of some ABA-regulated genes. Comparison of seed and ABA-inducible vegetative gene expression in wild-type and abi5-1 plants indicates that ABI5 regulates a subset of late embryogenesis-abundant genes during both developmental stages.
UniProtParticipates in ABA-regulated gene expression during seed development and subsequent vegetative stage by acting as the major mediator of ABA repression of growth. Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 and Em6 genes promoters. Can also trans-activate its own promoter, suggesting that it is autoregulated. Plays a role in sugar-mediated senescence. {ECO:0000269|PubMed:11287670, ECO:0000269|PubMed:12000684, ECO:0000269|PubMed:12084834, ECO:0000269|PubMed:12177466, ECO:0000269|PubMed:12410810, ECO:0000269|PubMed:12434021, ECO:0000269|PubMed:15118859, ECO:0000269|PubMed:16247556, ECO:0000269|PubMed:16463099}.
Function -- GeneRIF ? help Back to Top
  1. The redundancy of function among genes in the families of ABF3 and ABI5 in A. thaliana is reported.
    [PMID: 16247556]
  2. Results show that over-expression of ABI5 rendered phas expression ABA-independent in the presence of PvALF.
    [PMID: 18038114]
  3. PRT6 control of germination and establishment, as exemplified by ABA and sugar sensitivity, as well as storage oil mobilization, occurs at least in part via transcription factors ABI3 and ABI5.
    [PMID: 19255443]
  4. SIZ1-dependent sumoylation of ABI5 attenuates abscisic acid signaling
    [PMID: 19276109]
  5. Abscisic acid promotes ABI5 accumulation by inducing the ubiquitination and proteasomal degradation of KEG.
    [PMID: 20682837]
  6. one-hybrid assays demonstrated synergistic action of ABI4 with ABI5 or related bZIP factors in regulating target promoters, and mutant analyses showed that ABI4 and these bZIPs share some functions
    [PMID: 21243515]
  7. MED25 physically associates with the basic Leu zipper transcription factor ABA-INSENSITIVE5 (ABI5) in promoter regions of ABI5 target genes and shows a negative effect on ABI5-regulated gene transcription.
    [PMID: 22822206]
  8. These data suggest that Ala214 in ABI5 contributes to the function of ABI5 via its interaction with ABI3.
    [PMID: 23299338]
  9. The inhibitory effect of abscisic acid on floral transition is mediated by ABI5.
    [PMID: 23307919]
  10. ABI5 phosphorylation is regulated by PP6 phosphatase.
    [PMID: 23404889]
  11. Data indicate that KEEP ON GOING (KEG) E3 interacts with abscisic acid insensitive 5 (ABI5) in the cytoplasm.
    [PMID: 23720747]
  12. ABI4 and ABI5 synergistically regulate DGAT1 expression in Arabidopsis seedlings under stress.
    [PMID: 23942253]
  13. The function of AtSAG in abscisic acid (ABA)signalling depended on ABI3 and ABI5. AtSAG is an important negative regulator of ABA signalling during seed germination and seedling development.
    [PMID: 24163287]
  14. ABI5 functions in the glucose-mediated inhibition of the root meristem zone by repressing PIN1 accumulation, thus leading to reduced auxin levels in roots.
    [PMID: 24237322]
  15. Overexpression of TAP46 and inhibition of activities of PP2A or PP2A-like protein phosphatases can increase transcript levels of several ABI5-regulated genes.
    [PMID: 24357600]
  16. ubiquitination promotes AB15 degradation; sumoylation prohibits degradation
    [PMID: 24398698]
  17. These results define a genetic pathway through which cytokinin specifically induces the degradation of ABI5 protein.
    [PMID: 24443524]
  18. Transgenic cotton (Gossypium hirsutum) expressing AtRAV1/2 and/or AtABI5 showed resistance to imposed drought stress.
    [PMID: 24483851]
  19. our study indicates that BBX21 coordinates with HY5 and ABI5 on the ABI5 promoter and that these transcriptional regulators work in concert to integrate light and ABA signaling in Arabidopsis thaliana.
    [PMID: 24586210]
  20. results suggest that ABA negatively regulates SHB1 expression, at least in part, through the action of its downstream signaling component ABI5
    [PMID: 24619610]
  21. AtMyb7 negatively controls the expression of the gene encoding bZIP transcription factor, ABI5, which is a key transcription factor in abscisic acid (ABA) signalling and serves as a crucial regulator of germination inhibition in Arabidopsis.
    [PMID: 25053018]
  22. RAV1 plays an important role in abscisic acid signaling by modulating the expression of ABI3, ABI4, and AbI5 during seed germination and early seedling development.
    [PMID: 25231920]
  23. BIN2 phosphorylates and stabilizes ABI5 to mediate Abscisic acid (ABA) response during seed germination, while brassinosteroids (BRs) repress the BIN2-ABI5 cascade to antagonize ABA-mediated inhibition.
    [PMID: 25415975]
  24. PKS5-mediated phosphorylation of ABI5 at Ser-42 is critical for the abscissic acid regulation of seed germination and gene expression in Arabidopsis.
    [PMID: 25858916]
  25. RGL2 promotes the entrance in secondary dormancy through ABI5 action.
    [PMID: 26177669]
  26. link between nitric oxide and abscisic acid hormone signalling through distinct posttranslational modifications of ABI5 during early seedling development
    [PMID: 26493030]
  27. These results suggested important roles of CRWNs in ABI5 nuclear body organization and ABI5 protein degradation during seed germination.
    [PMID: 26564029]
  28. DOG1 affects the expression of hundreds of genes including LATE EMBRYOGENESIS ABUNDANT and HEAT SHOCK PROTEIN genes which are affected by DOG1 partly via control of ABI5 expression.
    [PMID: 26729600]
  29. ABI5 bind to the ABR promoter, indicating that ABI5 directly regulates the expression of ABR. The disruption of ABI5 function in abr abi5-1 plants abolished the senescence-accelerating phenotype of the abr mutant, demonstrating that ABI5 is epistatic to ABR.
    [PMID: 27095403]
  30. ABI5 is a direct target gene of BZR1, and modulating the expression of ABI5 by BZR1 plays important roles in regulating the crosstalk between the brassinosteroid and abscisic acid signalling pathways.
    [PMID: 27149247]
  31. Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin
    [PMID: 27317674]
  32. All of the study findings suggest that ABI5 regulates seed germination at least partly by affecting ROS homeostasis.
    [PMID: 28391398]
  33. Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression
    [PMID: 28438576]
  34. NF-YC9 mediates abscisic acid (ABA) signaling via targeting to and aiding the ABA-responsive transcription factors such as ABI5.
    [PMID: 28924726]
  35. These data demonstrate that PHO1 is involved in ABA-mediated seed germination and early seedling development and transcriptionally regulated by ABI5.
    [PMID: 29089393]
  36. SOM is reported to negatively regulate seeds germination by altering GA/ABA metabolism, here we found that AFP2 and ABI5 altered SOM transcription. Data demonstrate that AFP2 is a novel regulator to control high temperature-induced secondary seed dormancy through ABI5 and SOM.
    [PMID: 29723526]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G36270.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and glucose or 2-deoxy-glucose (2DG). Autoregulated. Positively regulated by the light-signaling component HY5. {ECO:0000269|PubMed:11287670, ECO:0000269|PubMed:12177466, ECO:0000269|PubMed:12376636, ECO:0000269|PubMed:12970489, ECO:0000269|PubMed:16463099, ECO:0000269|PubMed:18332440}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G14920 (A), AT1G21970 (A), AT1G28300 (R), AT2G01570 (A), AT2G20180 (A), AT2G36270 (A), AT2G40220 (A), AT3G03450 (A), AT3G24650 (A), AT5G11260 (A), AT5G56270 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT2G36270(A), AT2G40170(A), AT2G41940(R), AT3G11410(A), AT3G51810(A), AT4G16160(A), AT5G56270(A), AT5G65165(A), AT5G66400(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT3G24650ABI5 interacts with ABI3.
BINDAT2G36270ABI5 interacts with another molecule of ABI5 to form a homodimer.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G36270, AT2G41070, AT3G24650, AT4G27410, AT4G34000, AT5G37260, AT5G54230, AT1G10585, AT1G14920, AT1G22190, AT1G49720, AT1G52890, AT1G77450
IntActSearch Q9SJN0
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Exhibits abscisic acid (ABA) insensitivity. {ECO:0000269|PubMed:10929936}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G36270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3342060.0AF334206.1 Arabidopsis thaliana bZIP protein mRNA, complete cds.
GenBankBT0265170.0BT026517.1 Arabidopsis thaliana At2g36270 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001324735.10.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_565840.10.0Basic-leucine zipper (bZIP) transcription factor family protein
SwissprotQ9SJN00.0ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A178VU220.0A0A178VU22_ARATH; GIA1
STRINGAT2G36270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Representative plantOGRP5401580
Publications ? help Back to Top
  1. Choi H,Hong J,Ha J,Kang J,Kim SY
    ABFs, a family of ABA-responsive element binding factors.
    J. Biol. Chem., 2000. 275(3): p. 1723-30
    [PMID:10636868]
  2. Finkelstein RR,Lynch TJ
    The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor.
    Plant Cell, 2000. 12(4): p. 599-609
    [PMID:10760247]
  3. Lopez-Molina L,Chua NH
    A null mutation in a bZIP factor confers ABA-insensitivity in Arabidopsis thaliana.
    Plant Cell Physiol., 2000. 41(5): p. 541-7
    [PMID:10929936]
  4. Arenas-Huertero F,Arroyo A,Zhou L,Sheen J,León P
    Analysis of Arabidopsis glucose insensitive mutants, gin5 and gin6, reveals a central role of the plant hormone ABA in the regulation of plant vegetative development by sugar.
    Genes Dev., 2000. 14(16): p. 2085-96
    [PMID:10950871]
  5. Laby RJ,Kincaid MS,Kim D,Gibson SI
    The Arabidopsis sugar-insensitive mutants sis4 and sis5 are defective in abscisic acid synthesis and response.
    Plant J., 2000. 23(5): p. 587-96
    [PMID:10972885]
  6. Riechmann JL,Ratcliffe OJ
    A genomic perspective on plant transcription factors.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34
    [PMID:11019812]
  7. S
    Regulation and function of the Arabidopsis ABA-insensitive4 gene in seed and abscisic acid response signaling networks.
    Plant Physiol., 2000. 124(4): p. 1752-65
    [PMID:11115891]
  8. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  9. Lopez-Molina L,Mongrand S,Chua NH
    A postgermination developmental arrest checkpoint is mediated by abscisic acid and requires the ABI5 transcription factor in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(8): p. 4782-7
    [PMID:11287670]
  10. Nakamura S,Lynch TJ,Finkelstein RR
    Physical interactions between ABA response loci of Arabidopsis.
    Plant J., 2001. 26(6): p. 627-35
    [PMID:11489176]
  11. Gampala SS,Finkelstein RR,Sun SS,Rock CD
    ABI5 interacts with abscisic acid signaling effectors in rice protoplasts.
    J. Biol. Chem., 2002. 277(3): p. 1689-94
    [PMID:11704678]
  12. Signora L,De Smet I,Foyer CH,Zhang H
    ABA plays a central role in mediating the regulatory effects of nitrate on root branching in Arabidopsis.
    Plant J., 2001. 28(6): p. 655-62
    [PMID:11851911]
  13. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  14. Carles C, et al.
    Regulation of Arabidopsis thaliana Em genes: role of ABI5.
    Plant J., 2002. 30(3): p. 373-83
    [PMID:12000684]
  15. Finkelstein RR,Gampala SS,Rock CD
    Abscisic acid signaling in seeds and seedlings.
    Plant Cell, 2002. 14 Suppl: p. S15-45
    [PMID:12045268]
  16. Bensmihen S, et al.
    The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.
    Plant Cell, 2002. 14(6): p. 1391-403
    [PMID:12084834]
  17. Nambara E, et al.
    A screen for genes that function in abscisic acid signaling in Arabidopsis thaliana.
    Genetics, 2002. 161(3): p. 1247-55
    [PMID:12136027]
  18. Brocard IM,Lynch TJ,Finkelstein RR
    Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response.
    Plant Physiol., 2002. 129(4): p. 1533-43
    [PMID:12177466]
  19. Kim SY,Ma J,Perret P,Li Z,Thomas TL
    Arabidopsis ABI5 subfamily members have distinct DNA-binding and transcriptional activities.
    Plant Physiol., 2002. 130(2): p. 688-97
    [PMID:12376636]
  20. Johnson RR,Wagner RL,Verhey SD,Walker-Simmons MK
    The abscisic acid-responsive kinase PKABA1 interacts with a seed-specific abscisic acid response element-binding factor, TaABF, and phosphorylates TaABF peptide sequences.
    Plant Physiol., 2002. 130(2): p. 837-46
    [PMID:12376648]
  21. Lopez-Molina L,Mongrand S,McLachlin DT,Chait BT,Chua NH
    ABI5 acts downstream of ABI3 to execute an ABA-dependent growth arrest during germination.
    Plant J., 2002. 32(3): p. 317-28
    [PMID:12410810]
  22. Lu C,Han MH,Guevara-Garcia A,Fedoroff NV
    Mitogen-activated protein kinase signaling in postgermination arrest of development by abscisic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(24): p. 15812-7
    [PMID:12434021]
  23. Brocard-Gifford IM,Lynch TJ,Finkelstein RR
    Regulatory networks in seeds integrating developmental, abscisic acid, sugar, and light signaling.
    Plant Physiol., 2003. 131(1): p. 78-92
    [PMID:12529517]
  24. Lopez-Molina L,Mongrand S,Kinoshita N,Chua NH
    AFP is a novel negative regulator of ABA signaling that promotes ABI5 protein degradation.
    Genes Dev., 2003. 17(3): p. 410-8
    [PMID:12569131]
  25. Brady SM,Sarkar SF,Bonetta D,McCourt P
    The ABSCISIC ACID INSENSITIVE 3 (ABI3) gene is modulated by farnesylation and is involved in auxin signaling and lateral root development in Arabidopsis.
    Plant J., 2003. 34(1): p. 67-75
    [PMID:12662310]
  26. León P,Sheen J
    Sugar and hormone connections.
    Trends Plant Sci., 2003. 8(3): p. 110-6
    [PMID:12663220]
  27. Smalle J, et al.
    The pleiotropic role of the 26S proteasome subunit RPN10 in Arabidopsis growth and development supports a substrate-specific function in abscisic acid signaling.
    Plant Cell, 2003. 15(4): p. 965-80
    [PMID:12671091]
  28. Johannesson H,Wang Y,Hanson J,Engström P
    The Arabidopsis thaliana homeobox gene ATHB5 is a potential regulator of abscisic acid responsiveness in developing seedlings.
    Plant Mol. Biol., 2003. 51(5): p. 719-29
    [PMID:12678559]
  29. Suzuki M,Ketterling MG,Li QB,McCarty DR
    Viviparous1 alters global gene expression patterns through regulation of abscisic acid signaling.
    Plant Physiol., 2003. 132(3): p. 1664-77
    [PMID:12857845]
  30. Chandrasekharan MB,Li G,Bishop KJ,Hall TC
    S phase progression is required for transcriptional activation of the beta-phaseolin promoter.
    J. Biol. Chem., 2003. 278(46): p. 45397-405
    [PMID:12960166]
  31. Duque P,Chua NH
    IMB1, a bromodomain protein induced during seed imbibition, regulates ABA- and phyA-mediated responses of germination in Arabidopsis.
    Plant J., 2003. 35(6): p. 787-99
    [PMID:12969431]
  32. Arroyo A,Bossi F,Finkelstein RR,Le
    Three genes that affect sugar sensing (abscisic acid insensitive 4, abscisic acid insensitive 5, and constitutive triple response 1) are differentially regulated by glucose in Arabidopsis.
    Plant Physiol., 2003. 133(1): p. 231-42
    [PMID:12970489]
  33. Haslek
    Seed 1-cysteine peroxiredoxin antioxidants are not involved in dormancy, but contribute to inhibition of germination during stress.
    Plant Physiol., 2003. 133(3): p. 1148-57
    [PMID:14526116]
  34. Dekkers BJ,Schuurmans JA,Smeekens SC
    Glucose delays seed germination in Arabidopsis thaliana.
    Planta, 2004. 218(4): p. 579-88
    [PMID:14648119]
  35. Brocard-Gifford I,Lynch TJ,Garcia ME,Malhotra B,Finkelstein RR
    The Arabidopsis thaliana ABSCISIC ACID-INSENSITIVE8 encodes a novel protein mediating abscisic acid and sugar responses essential for growth.
    Plant Cell, 2004. 16(2): p. 406-21
    [PMID:14742875]
  36. Haslek
    ABI3 mediates expression of the peroxiredoxin antioxidant AtPER1 gene and induction by oxidative stress.
    Plant Mol. Biol., 2003. 53(3): p. 313-26
    [PMID:14750521]
  37. Bensmihen S, et al.
    Analysis of an activated ABI5 allele using a new selection method for transgenic Arabidopsis seeds.
    FEBS Lett., 2004. 561(1-3): p. 127-31
    [PMID:15013763]
  38. Pourtau N, et al.
    Interactions of abscisic acid and sugar signalling in the regulation of leaf senescence.
    Planta, 2004. 219(5): p. 765-72
    [PMID:15118859]
  39. Bensmihen S,Giraudat J,Parcy F
    Characterization of three homologous basic leucine zipper transcription factors (bZIP) of the ABI5 family during Arabidopsis thaliana embryo maturation.
    J. Exp. Bot., 2005. 56(412): p. 597-603
    [PMID:15642716]
  40. Nakabayashi K,Okamoto M,Koshiba T,Kamiya Y,Nambara E
    Genome-wide profiling of stored mRNA in Arabidopsis thaliana seed germination: epigenetic and genetic regulation of transcription in seed.
    Plant J., 2005. 41(5): p. 697-709
    [PMID:15703057]
  41. Li F,Wu X,Tsang E,Cutler AJ
    Transcriptional profiling of imbibed Brassica napus seed.
    Genomics, 2005. 86(6): p. 718-30
    [PMID:16125897]
  42. Finkelstein R,Gampala SS,Lynch TJ,Thomas TL,Rock CD
    Redundant and distinct functions of the ABA response loci ABA-INSENSITIVE(ABI)5 and ABRE-BINDING FACTOR (ABF)3.
    Plant Mol. Biol., 2005. 59(2): p. 253-67
    [PMID:16247556]
  43. Yoshida T, et al.
    ABA-hypersensitive germination3 encodes a protein phosphatase 2C (AtPP2CA) that strongly regulates abscisic acid signaling during germination among Arabidopsis protein phosphatase 2Cs.
    Plant Physiol., 2006. 140(1): p. 115-26
    [PMID:16339800]
  44. Nakashima K, et al.
    Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.
    Plant Mol. Biol., 2006. 60(1): p. 51-68
    [PMID:16463099]
  45. Drea SC,Lao NT,Wolfe KH,Kavanagh TA
    Gene duplication, exon gain and neofunctionalization of OEP16-related genes in land plants.
    Plant J., 2006. 46(5): p. 723-35
    [PMID:16709189]
  46. Marella HH,Sakata Y,Quatrano RS
    Characterization and functional analysis of ABSCISIC ACID INSENSITIVE3-like genes from Physcomitrella patens.
    Plant J., 2006. 46(6): p. 1032-44
    [PMID:16805735]
  47. Penfield S,Li Y,Gilday AD,Graham S,Graham IA
    Arabidopsis ABA INSENSITIVE4 regulates lipid mobilization in the embryo and reveals repression of seed germination by the endosperm.
    Plant Cell, 2006. 18(8): p. 1887-99
    [PMID:16844907]
  48. Stone SL,Williams LA,Farmer LM,Vierstra RD,Callis J
    KEEP ON GOING, a RING E3 ligase essential for Arabidopsis growth and development, is involved in abscisic acid signaling.
    Plant Cell, 2006. 18(12): p. 3415-28
    [PMID:17194765]
  49. Reyes JL,Chua NH
    ABA induction of miR159 controls transcript levels of two MYB factors during Arabidopsis seed germination.
    Plant J., 2007. 49(4): p. 592-606
    [PMID:17217461]
  50. Fujii H,Verslues PE,Zhu JK
    Identification of two protein kinases required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 485-94
    [PMID:17307925]
  51. Nishimura N, et al.
    ABA-Hypersensitive Germination1 encodes a protein phosphatase 2C, an essential component of abscisic acid signaling in Arabidopsis seed.
    Plant J., 2007. 50(6): p. 935-49
    [PMID:17461784]
  52. Wang H,Guo J,Lambert KN,Lin Y
    Developmental control of Arabidopsis seed oil biosynthesis.
    Planta, 2007. 226(3): p. 773-83
    [PMID:17522888]
  53. Zhang Y, et al.
    SDIR1 is a RING finger E3 ligase that positively regulates stress-responsive abscisic acid signaling in Arabidopsis.
    Plant Cell, 2007. 19(6): p. 1912-29
    [PMID:17573536]
  54. Gan Y,Yu H,Peng J,Broun P
    Genetic and molecular regulation by DELLA proteins of trichome development in Arabidopsis.
    Plant Physiol., 2007. 145(3): p. 1031-42
    [PMID:17704233]
  55. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  56. Perruc E,Kinoshita N,Lopez-Molina L
    The role of chromatin-remodeling factor PKL in balancing osmotic stress responses during Arabidopsis seed germination.
    Plant J., 2007. 52(5): p. 927-36
    [PMID:17892443]
  57. W-K Ng D,Hall TC
    PvALF and FUS3 activate expression from the phaseolin promoter by different mechanisms.
    Plant Mol. Biol., 2008. 66(3): p. 233-44
    [PMID:18038114]
  58. Chung S,Parish RW
    Combinatorial interactions of multiple cis-elements regulating the induction of the Arabidopsis XERO2 dehydrin gene by abscisic acid and cold.
    Plant J., 2008. 54(1): p. 15-29
    [PMID:18088305]
  59. Liu PF,Chang WC,Wang YK,Chang HY,Pan RL
    Signaling pathways mediating the suppression of Arabidopsis thaliana Ku gene expression by abscisic acid.
    Biochim. Biophys. Acta, 2008. 1779(3): p. 164-74
    [PMID:18179780]
  60. Bies-Eth
    Inventory, evolution and expression profiling diversity of the LEA (late embryogenesis abundant) protein gene family in Arabidopsis thaliana.
    Plant Mol. Biol., 2008. 67(1-2): p. 107-24
    [PMID:18265943]
  61. Dekkers BJ,Schuurmans JA,Smeekens SC
    Interaction between sugar and abscisic acid signalling during early seedling development in Arabidopsis.
    Plant Mol. Biol., 2008. 67(1-2): p. 151-67
    [PMID:18278579]
  62. Shobbar ZS, et al.
    Abscisic acid regulates gene expression in cortical fiber cells and silica cells of rice shoots.
    New Phytol., 2008. 178(1): p. 68-79
    [PMID:18315698]
  63. Chen H, et al.
    Integration of light and abscisic acid signaling during seed germination and early seedling development.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(11): p. 4495-500
    [PMID:18332440]
  64. Bassel GW, et al.
    Elucidating the germination transcriptional program using small molecules.
    Plant Physiol., 2008. 147(1): p. 143-55
    [PMID:18359847]
  65. Papdi C, et al.
    Functional identification of Arabidopsis stress regulatory genes using the controlled cDNA overexpression system.
    Plant Physiol., 2008. 147(2): p. 528-42
    [PMID:18441225]
  66. Santos-Mendoza M, et al.
    Deciphering gene regulatory networks that control seed development and maturation in Arabidopsis.
    Plant J., 2008. 54(4): p. 608-20
    [PMID:18476867]
  67. Garcia ME,Lynch T,Peeters J,Snowden C,Finkelstein R
    A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings.
    Plant Mol. Biol., 2008. 67(6): p. 643-58
    [PMID:18484180]
  68. Ohnishi N,Himi E,Yamasaki Y,Noda K
    Differential expression of three ABA-insensitive five binding protein (AFP)-like genes in wheat.
    Genes Genet. Syst., 2008. 83(2): p. 167-77
    [PMID:18506100]
  69. Wawrzynska A,Christiansen KM,Lan Y,Rodibaugh NL,Innes RW
    Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.
    Plant Physiol., 2008. 148(3): p. 1510-22
    [PMID:18815384]
  70. Piskurewicz U, et al.
    The gibberellic acid signaling repressor RGL2 inhibits Arabidopsis seed germination by stimulating abscisic acid synthesis and ABI5 activity.
    Plant Cell, 2008. 20(10): p. 2729-45
    [PMID:18941053]
  71. Yamagishi K, et al.
    CHOTTO1, a double AP2 domain protein of Arabidopsis thaliana, regulates germination and seedling growth under excess supply of glucose and nitrate.
    Plant Cell Physiol., 2009. 50(2): p. 330-40
    [PMID:19109301]
  72. Yamamoto A, et al.
    Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors.
    Plant J., 2009. 58(5): p. 843-56
    [PMID:19207209]
  73. Oh E, et al.
    Genome-wide analysis of genes targeted by PHYTOCHROME INTERACTING FACTOR 3-LIKE5 during seed germination in Arabidopsis.
    Plant Cell, 2009. 21(2): p. 403-19
    [PMID:19244139]
  74. Holman TJ, et al.
    The N-end rule pathway promotes seed germination and establishment through removal of ABA sensitivity in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(11): p. 4549-54
    [PMID:19255443]
  75. Roschzttardtz H, et al.
    A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.
    Plant Physiol., 2009. 150(1): p. 84-95
    [PMID:19261733]
  76. Gagete AP,Riera M,Franco L,Rodrigo MI
    Functional analysis of the isoforms of an ABI3-like factor of Pisum sativum generated by alternative splicing.
    J. Exp. Bot., 2009. 60(6): p. 1703-14
    [PMID:19261920]
  77. Yang YT,Yu YL,Yang GD,Zhang JD,Zheng CC
    Tissue-specific expression of the PNZIP promoter is mediated by combinatorial interaction of different cis-elements and a novel transcriptional factor.
    Nucleic Acids Res., 2009. 37(8): p. 2630-44
    [PMID:19270069]
  78. Miura K, et al.
    Sumoylation of ABI5 by the Arabidopsis SUMO E3 ligase SIZ1 negatively regulates abscisic acid signaling.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(13): p. 5418-23
    [PMID:19276109]
  79. Bu Q, et al.
    The Arabidopsis RING finger E3 ligase RHA2a is a novel positive regulator of abscisic acid signaling during seed germination and early seedling development.
    Plant Physiol., 2009. 150(1): p. 463-81
    [PMID:19286935]
  80. Bossi F, et al.
    The Arabidopsis ABA-INSENSITIVE (ABI) 4 factor acts as a central transcription activator of the expression of its own gene, and for the induction of ABI5 and SBE2.2 genes during sugar signaling.
    Plant J., 2009. 59(3): p. 359-74
    [PMID:19392689]
  81. Nakashima K, et al.
    Three Arabidopsis SnRK2 protein kinases, SRK2D/SnRK2.2, SRK2E/SnRK2.6/OST1 and SRK2I/SnRK2.3, involved in ABA signaling are essential for the control of seed development and dormancy.
    Plant Cell Physiol., 2009. 50(7): p. 1345-63
    [PMID:19541597]
  82. Jiang W,Yu D
    Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid.
    BMC Plant Biol., 2009. 9: p. 96
    [PMID:19622176]
  83. Belin C,Lopez-Molina L
    Arabidopsis seed germination responses to osmotic stress involve the chromatin modifier PICKLE.
    Plant Signal Behav, 2008. 3(7): p. 478-9
    [PMID:19704491]
  84. Graeber K, et al.
    Cross-species approaches to seed dormancy and germination: conservation and biodiversity of ABA-regulated mechanisms and the Brassicaceae DOG1 genes.
    Plant Mol. Biol., 2010. 73(1-2): p. 67-87
    [PMID:20013031]
  85. Kinoshita N, et al.
    Identification of growth insensitive to ABA3 (gia3), a recessive mutation affecting ABA Signaling for the control of early post-germination growth in Arabidopsis thaliana.
    Plant Cell Physiol., 2010. 51(2): p. 239-51
    [PMID:20022976]
  86. Kanai M,Nishimura M,Hayashi M
    A peroxisomal ABC transporter promotes seed germination by inducing pectin degradation under the control of ABI5.
    Plant J., 2010. 62(6): p. 936-47
    [PMID:20345608]
  87. Wang XJ, et al.
    Two coupled components of the mitogen-activated protein kinase cascade MdMPK1 and MdMKK1 from apple function in ABA signal transduction.
    Plant Cell Physiol., 2010. 51(5): p. 754-66
    [PMID:20360020]
  88. Lee JH, et al.
    DWA1 and DWA2, two Arabidopsis DWD protein components of CUL4-based E3 ligases, act together as negative regulators in ABA signal transduction.
    Plant Cell, 2010. 22(6): p. 1716-32
    [PMID:20525848]
  89. Shang Y, et al.
    The Mg-chelatase H subunit of Arabidopsis antagonizes a group of WRKY transcription repressors to relieve ABA-responsive genes of inhibition.
    Plant Cell, 2010. 22(6): p. 1909-35
    [PMID:20543028]
  90. Xi W,Liu C,Hou X,Yu H
    MOTHER OF FT AND TFL1 regulates seed germination through a negative feedback loop modulating ABA signaling in Arabidopsis.
    Plant Cell, 2010. 22(6): p. 1733-48
    [PMID:20551347]
  91. Hoth S,Niedermeier M,Feuerstein A,Hornig J,Sauer N
    An ABA-responsive element in the AtSUC1 promoter is involved in the regulation of AtSUC1 expression.
    Planta, 2010. 232(4): p. 911-23
    [PMID:20635094]
  92. Liu H,Stone SL
    Abscisic acid increases Arabidopsis ABI5 transcription factor levels by promoting KEG E3 ligase self-ubiquitination and proteasomal degradation.
    Plant Cell, 2010. 22(8): p. 2630-41
    [PMID:20682837]
  93. Carvalho RF,Carvalho SD,Duque P
    The plant-specific SR45 protein negatively regulates glucose and ABA signaling during early seedling development in Arabidopsis.
    Plant Physiol., 2010. 154(2): p. 772-83
    [PMID:20699397]
  94. Li G, et al.
    Two cotton Cys2/His2-type zinc-finger proteins, GhDi19-1 and GhDi19-2, are involved in plant response to salt/drought stress and abscisic acid signaling.
    Plant Mol. Biol., 2010. 74(4-5): p. 437-52
    [PMID:20852918]
  95. Reeves WM,Lynch TJ,Mobin R,Finkelstein RR
    Direct targets of the transcription factors ABA-Insensitive(ABI)4 and ABI5 reveal synergistic action by ABI4 and several bZIP ABA response factors.
    Plant Mol. Biol., 2011. 75(4-5): p. 347-63
    [PMID:21243515]
  96. Ufaz S, et al.
    Transcriptional control of aspartate kinase expression during darkness and sugar depletion in Arabidopsis: involvement of bZIP transcription factors.
    Planta, 2011. 233(5): p. 1025-40
    [PMID:21279647]
  97. Fujita Y,Fujita M,Shinozaki K,Yamaguchi-Shinozaki K
    ABA-mediated transcriptional regulation in response to osmotic stress in plants.
    J. Plant Res., 2011. 124(4): p. 509-25
    [PMID:21416314]
  98. Lee JH,Terzaghi W,Deng XW
    DWA3, an Arabidopsis DWD protein, acts as a negative regulator in ABA signal transduction.
    Plant Sci., 2011. 180(2): p. 352-7
    [PMID:21421380]
  99. Yang Y,Yu X,Song L,An C
    ABI4 activates DGAT1 expression in Arabidopsis seedlings during nitrogen deficiency.
    Plant Physiol., 2011. 156(2): p. 873-83
    [PMID:21515696]
  100. Rushton DL, et al.
    WRKY transcription factors: key components in abscisic acid signalling.
    Plant Biotechnol. J., 2012. 10(1): p. 2-11
    [PMID:21696534]
  101. Wang Y, et al.
    Cytokinin antagonizes ABA suppression to seed germination of Arabidopsis by downregulating ABI5 expression.
    Plant J., 2011. 68(2): p. 249-61
    [PMID:21699589]
  102. Kerchev PI, et al.
    The transcription factor ABI4 Is required for the ascorbic acid-dependent regulation of growth and regulation of jasmonate-dependent defense signaling pathways in Arabidopsis.
    Plant Cell, 2011. 23(9): p. 3319-34
    [PMID:21926335]
  103. Jiang S, et al.
    The Arabidopsis mutant, fy-1, has an ABA-insensitive germination phenotype.
    J. Exp. Bot., 2012. 63(7): p. 2693-703
    [PMID:22282534]
  104. Tang N,Zhang H,Li X,Xiao J,Xiong L
    Constitutive activation of transcription factor OsbZIP46 improves drought tolerance in rice.
    Plant Physiol., 2012. 158(4): p. 1755-68
    [PMID:22301130]
  105. Dave A,Graham IA
    Oxylipin Signaling: A Distinct Role for the Jasmonic Acid Precursor cis-(+)-12-Oxo-Phytodienoic Acid (cis-OPDA).
    Front Plant Sci, 2012. 3: p. 42
    [PMID:22645585]
  106. Luo X, et al.
    Over-expression of GsZFP1, an ABA-responsive C2H2-type zinc finger protein lacking a QALGGH motif, reduces ABA sensitivity and decreases stomata size.
    J. Plant Physiol., 2012. 169(12): p. 1192-202
    [PMID:22705253]
  107. Zheng Y,Schumaker KS,Guo Y
    Sumoylation of transcription factor MYB30 by the small ubiquitin-like modifier E3 ligase SIZ1 mediates abscisic acid response in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(31): p. 12822-7
    [PMID:22814374]
  108. Chen R, et al.
    The Arabidopsis mediator subunit MED25 differentially regulates jasmonate and abscisic acid signaling through interacting with the MYC2 and ABI5 transcription factors.
    Plant Cell, 2012. 24(7): p. 2898-916
    [PMID:22822206]
  109. Lee KP, et al.
    Spatially and genetically distinct control of seed germination by phytochromes A and B.
    Genes Dev., 2012. 26(17): p. 1984-96
    [PMID:22948663]
  110. Lynch T,Erickson BJ,Finkelstein RR
    Direct interactions of ABA-insensitive(ABI)-clade protein phosphatase(PP)2Cs with calcium-dependent protein kinases and ABA response element-binding bZIPs may contribute to turning off ABA response.
    Plant Mol. Biol., 2012. 80(6): p. 647-58
    [PMID:23007729]
  111. Liu ZQ, et al.
    Cooperation of three WRKY-domain transcription factors WRKY18, WRKY40, and WRKY60 in repressing two ABA-responsive genes ABI4 and ABI5 in Arabidopsis.
    J. Exp. Bot., 2012. 63(18): p. 6371-92
    [PMID:23095997]
  112. Han SK, et al.
    The SWI2/SNF2 chromatin remodeling ATPase BRAHMA represses abscisic acid responses in the absence of the stress stimulus in Arabidopsis.
    Plant Cell, 2012. 24(12): p. 4892-906
    [PMID:23209114]
  113. Zhou X, et al.
    Molecular characterization of an ABA insensitive 5 orthologue in Brassica oleracea.
    Biochem. Biophys. Res. Commun., 2013. 430(3): p. 1140-6
    [PMID:23246838]
  114. Tezuka K,Taji T,Hayashi T,Sakata Y
    A novel abi5 allele reveals the importance of the conserved Ala in the C3 domain for regulation of downstream genes and salt tolerance during germination in Arabidopsis.
    Plant Signal Behav, 2013. 8(3): p. e23455
    [PMID:23299338]
  115. Wang Y, et al.
    The inhibitory effect of ABA on floral transition is mediated by ABI5 in Arabidopsis.
    J. Exp. Bot., 2013. 64(2): p. 675-84
    [PMID:23307919]
  116. Miao H, et al.
    Glucose signalling positively regulates aliphatic glucosinolate biosynthesis.
    J. Exp. Bot., 2013. 64(4): p. 1097-109
    [PMID:23329848]
  117. Fukumoto T, et al.
    Phosphorylation of D-allose by hexokinase involved in regulation of OsABF1 expression for growth inhibition in Oryza sativa L.
    Planta, 2013. 237(5): p. 1379-91
    [PMID:23397192]
  118. Dai M, et al.
    The PP6 phosphatase regulates ABI5 phosphorylation and abscisic acid signaling in Arabidopsis.
    Plant Cell, 2013. 25(2): p. 517-34
    [PMID:23404889]
  119. Footitt S,Huang Z,Clay HA,Mead A,Finch-Savage WE
    Temperature, light and nitrate sensing coordinate Arabidopsis seed dormancy cycling, resulting in winter and summer annual phenotypes.
    Plant J., 2013. 74(6): p. 1003-15
    [PMID:23590427]
  120. Luo X, et al.
    Expression of wild soybean WRKY20 in Arabidopsis enhances drought tolerance and regulates ABA signalling.
    J. Exp. Bot., 2013. 64(8): p. 2155-69
    [PMID:23606412]
  121. Li YJ, et al.
    NFYA1 is involved in regulation of postgermination growth arrest under salt stress in Arabidopsis.
    PLoS ONE, 2013. 8(4): p. e61289
    [PMID:23637805]
  122. Lyzenga WJ,Liu H,Schofield A,Muise-Hennessey A,Stone SL
    Arabidopsis CIPK26 interacts with KEG, components of the ABA signalling network and is degraded by the ubiquitin-proteasome system.
    J. Exp. Bot., 2013. 64(10): p. 2779-91
    [PMID:23658427]
  123. Kim D, et al.
    BLH1 and KNAT3 modulate ABA responses during germination and early seedling development in Arabidopsis.
    Plant J., 2013. 75(5): p. 755-66
    [PMID:23663178]
  124. Liu H,Stone SL
    Cytoplasmic degradation of the Arabidopsis transcription factor abscisic acid insensitive 5 is mediated by the RING-type E3 ligase KEEP ON GOING.
    J. Biol. Chem., 2013. 288(28): p. 20267-79
    [PMID:23720747]
  125. Chen YT,Liu H,Stone S,Callis J
    ABA and the ubiquitin E3 ligase KEEP ON GOING affect proteolysis of the Arabidopsis thaliana transcription factors ABF1 and ABF3.
    Plant J., 2013. 75(6): p. 965-76
    [PMID:23742014]
  126. Vaistij FE, et al.
    Differential control of seed primary dormancy in Arabidopsis ecotypes by the transcription factor SPATULA.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(26): p. 10866-71
    [PMID:23754415]
  127. Li XY, et al.
    Overexpression of Arachis hypogaea AREB1 gene enhances drought tolerance by modulating ROS scavenging and maintaining endogenous ABA content.
    Int J Mol Sci, 2013. 14(6): p. 12827-42
    [PMID:23783278]
  128. Lin LL, et al.
    Identification of microRNA 395a in 24-epibrassinolide-regulated root growth of Arabidopsis thaliana using microRNA arrays.
    Int J Mol Sci, 2013. 14(7): p. 14270-86
    [PMID:23839095]
  129. Pizzio GA, et al.
    The PYL4 A194T mutant uncovers a key role of PYR1-LIKE4/PROTEIN PHOSPHATASE 2CA interaction for abscisic acid signaling and plant drought resistance.
    Plant Physiol., 2013. 163(1): p. 441-55
    [PMID:23864556]
  130. Kong Y,Chen S,Yang Y,An C
    ABA-insensitive (ABI) 4 and ABI5 synergistically regulate DGAT1 expression in Arabidopsis seedlings under stress.
    FEBS Lett., 2013. 587(18): p. 3076-82
    [PMID:23942253]
  131. Duarte GT, et al.
    Involvement of microRNA-related regulatory pathways in the glucose-mediated control of Arabidopsis early seedling development.
    J. Exp. Bot., 2013. 64(14): p. 4301-12
    [PMID:23997203]
  132. Kim DH,Xu ZY,Hwang I
    AtHSP17.8 overexpression in transgenic lettuce gives rise to dehydration and salt stress resistance phenotypes through modulation of ABA-mediated signaling.
    Plant Cell Rep., 2013. 32(12): p. 1953-63
    [PMID:24081610]
  133. Lei GJ, et al.
    Abscisic acid alleviates iron deficiency by promoting root iron reutilization and transport from root to shoot in Arabidopsis.
    Plant Cell Environ., 2014. 37(4): p. 852-63
    [PMID:24111973]
  134. Guo R, et al.
    Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(18): p. 5707-19
    [PMID:24151308]
  135. Chen C, et al.
    Arabidopsis SAG protein containing the MDN1 domain participates in seed germination and seedling development by negatively regulating ABI3 and ABI5.
    J. Exp. Bot., 2014. 65(1): p. 35-45
    [PMID:24163287]
  136. Bu Q, et al.
    Regulation of drought tolerance by the F-box protein MAX2 in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 424-39
    [PMID:24198318]
  137. Yuan TT,Xu HH,Zhang KX,Guo TT,Lu YT
    Glucose inhibits root meristem growth via ABA INSENSITIVE 5, which represses PIN1 accumulation and auxin activity in Arabidopsis.
    Plant Cell Environ., 2014. 37(6): p. 1338-50
    [PMID:24237322]
  138. Gao DY, et al.
    Functional analyses of an E3 ligase gene AIP2 from wheat in Arabidopsis revealed its roles in seed germination and pre-harvest sprouting.
    J Integr Plant Biol, 2014. 56(5): p. 480-91
    [PMID:24279988]
  139. Lim S, et al.
    ABA-insensitive3, ABA-insensitive5, and DELLAs Interact to activate the expression of SOMNUS and other high-temperature-inducible genes in imbibed seeds in Arabidopsis.
    Plant Cell, 2013. 25(12): p. 4863-78
    [PMID:24326588]
  140. Hu R,Zhu Y,Shen G,Zhang H
    TAP46 plays a positive role in the ABSCISIC ACID INSENSITIVE5-regulated gene expression in Arabidopsis.
    Plant Physiol., 2014. 164(2): p. 721-34
    [PMID:24357600]
  141. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  142. Qin Y,Tian Y,Han L,Yang X
    Constitutive expression of a salinity-induced wheat WRKY transcription factor enhances salinity and ionic stress tolerance in transgenic Arabidopsis thaliana.
    Biochem. Biophys. Res. Commun., 2013. 441(2): p. 476-81
    [PMID:24383079]
  143. Liu H,Stone SL
    Regulation of ABI5 turnover by reversible post-translational modifications.
    Plant Signal Behav, 2014. 9(1): p. e27577
    [PMID:24398698]
  144. Guan C, et al.
    Cytokinin antagonizes abscisic acid-mediated inhibition of cotyledon greening by promoting the degradation of abscisic acid insensitive5 protein in Arabidopsis.
    Plant Physiol., 2014. 164(3): p. 1515-26
    [PMID:24443524]
  145. Lai Z, et al.
    MED18 interaction with distinct transcription factors regulates multiple plant functions.
    Nat Commun, 2014. 5: p. 3064
    [PMID:24451981]
  146. Mittal A, et al.
    Related to ABA-Insensitive3(ABI3)/Viviparous1 and AtABI5 transcription factor coexpression in cotton enhances drought stress adaptation.
    Plant Biotechnol. J., 2014. 12(5): p. 578-89
    [PMID:24483851]
  147. González-Grandío E,Cubas P
    Identification of gene functions associated to active and dormant buds in Arabidopsis.
    Plant Signal Behav, 2014. 9(2): p. e27994
    [PMID:24518068]
  148. Seo KI, et al.
    ABD1 is an Arabidopsis DCAF substrate receptor for CUL4-DDB1-based E3 ligases that acts as a negative regulator of abscisic acid signaling.
    Plant Cell, 2014. 26(2): p. 695-711
    [PMID:24563203]
  149. Xu D, et al.
    Convergence of Light and ABA signaling on the ABI5 promoter.
    PLoS Genet., 2014. 10(2): p. e1004197
    [PMID:24586210]
  150. Seifert GJ,Xue H,Acet T
    The Arabidopsis thaliana FASCICLIN LIKE ARABINOGALACTAN PROTEIN 4 gene acts synergistically with abscisic acid signalling to control root growth.
    Ann. Bot., 2014. 114(6): p. 1125-33
    [PMID:24603604]
  151. Cheng ZJ, et al.
    Abscisic acid regulates early seed development in Arabidopsis by ABI5-mediated transcription of SHORT HYPOCOTYL UNDER BLUE1.
    Plant Cell, 2014. 26(3): p. 1053-68
    [PMID:24619610]
  152. Joseph MP, et al.
    The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.
    Plant Physiol., 2014. 165(3): p. 1203-1220
    [PMID:24808098]
  153. Zhao H, et al.
    The Putative E3 Ubiquitin Ligase ECERIFERUM9 Regulates Abscisic Acid Biosynthesis and Response during Seed Germination and Postgermination Growth in Arabidopsis.
    Plant Physiol., 2014. 165(3): p. 1255-1268
    [PMID:24812105]
  154. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  155. Mei C, et al.
    Arabidopsis pentatricopeptide repeat protein SOAR1 plays a critical role in abscisic acid signalling.
    J. Exp. Bot., 2014. 65(18): p. 5317-30
    [PMID:25005137]
  156. Chen C, et al.
    ASCORBATE PEROXIDASE6 protects Arabidopsis desiccating and germinating seeds from stress and mediates cross talk between reactive oxygen species, abscisic acid, and auxin.
    Plant Physiol., 2014. 166(1): p. 370-83
    [PMID:25049361]
  157. Kim JH, et al.
    AtMyb7, a subgroup 4 R2R3 Myb, negatively regulates ABA-induced inhibition of seed germination by blocking the expression of the bZIP transcription factor ABI5.
    Plant Cell Environ., 2015. 38(3): p. 559-71
    [PMID:25053018]
  158. Feng CZ, et al.
    Arabidopsis RAV1 transcription factor, phosphorylated by SnRK2 kinases, regulates the expression of ABI3, ABI4, and ABI5 during seed germination and early seedling development.
    Plant J., 2014. 80(4): p. 654-68
    [PMID:25231920]
  159. Kim EY,Seo YS,Park KY,Kim SJ,Kim WT
    Overexpression of CaDSR6 increases tolerance to drought and salt stresses in transgenic Arabidopsis plants.
    Gene, 2014. 552(1): p. 146-54
    [PMID:25234727]
  160. Lee S,Lee HJ,Jung JH,Park CM
    The Arabidopsis thaliana RNA-binding protein FCA regulates thermotolerance by modulating the detoxification of reactive oxygen species.
    New Phytol., 2015. 205(2): p. 555-69
    [PMID:25266977]
  161. Bello B, et al.
    Cloning of Gossypium hirsutum sucrose non-fermenting 1-related protein kinase 2 gene (GhSnRK2) and its overexpression in transgenic Arabidopsis escalates drought and low temperature tolerance.
    PLoS ONE, 2014. 9(11): p. e112269
    [PMID:25393623]
  162. Hu Y,Yu D
    BRASSINOSTEROID INSENSITIVE2 interacts with ABSCISIC ACID INSENSITIVE5 to mediate the antagonism of brassinosteroids to abscisic acid during seed germination in Arabidopsis.
    Plant Cell, 2014. 26(11): p. 4394-408
    [PMID:25415975]
  163. Chen C,Twito S,Miller G
    New cross talk between ROS, ABA and auxin controlling seed maturation and germination unraveled in APX6 deficient Arabidopsis seeds.
    Plant Signal Behav, 2014. 9(12): p. e976489
    [PMID:25482750]
  164. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  165. Lu Y, et al.
    ABI1 regulates carbon/nitrogen-nutrient signal transduction independent of ABA biosynthesis and canonical ABA signalling pathways in Arabidopsis.
    J. Exp. Bot., 2015. 66(9): p. 2763-71
    [PMID:25795738]
  166. Zhou X, et al.
    SOS2-LIKE PROTEIN KINASE5, an SNF1-RELATED PROTEIN KINASE3-Type Protein Kinase, Is Important for Abscisic Acid Responses in Arabidopsis through Phosphorylation of ABSCISIC ACID-INSENSITIVE5.
    Plant Physiol., 2015. 168(2): p. 659-76
    [PMID:25858916]
  167. Lee HN,Lee KH,Kim CS
    Abscisic acid receptor PYRABACTIN RESISTANCE-LIKE 8, PYL8, is involved in glucose response and dark-induced leaf senescence in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2015 Jul 17-24. 463(1-2): p. 24-8
    [PMID:25983319]
  168. Ibarra SE, et al.
    Molecular mechanisms underlying the entrance in secondary dormancy of Arabidopsis seeds.
    Plant Cell Environ., 2016. 39(1): p. 213-21
    [PMID:26177669]
  169. Fernando VC,Schroeder DF
    Genetic interactions between DET1 and intermediate genes in Arabidopsis ABA signalling.
    Plant Sci., 2015. 239: p. 166-79
    [PMID:26398801]
  170. Zhong C, et al.
    Gibberellic Acid-Stimulated Arabidopsis6 Serves as an Integrator of Gibberellin, Abscisic Acid, and Glucose Signaling during Seed Germination in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2288-303
    [PMID:26400990]
  171. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  172. Albertos P, et al.
    S-nitrosylation triggers ABI5 degradation to promote seed germination and seedling growth.
    Nat Commun, 2015. 6: p. 8669
    [PMID:26493030]
  173. Zhang GZ, et al.
    Ectopic expression of UGT75D1, a glycosyltransferase preferring indole-3-butyric acid, modulates cotyledon development and stress tolerance in seed germination of Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 90(1-2): p. 77-93
    [PMID:26496910]
  174. Zhao W, et al.
    The Arabidopsis CROWDED NUCLEI genes regulate seed germination by modulating degradation of ABI5 protein.
    J Integr Plant Biol, 2016. 58(7): p. 669-78
    [PMID:26564029]
  175. Wu J, et al.
    Gladiolus hybridus ABSCISIC ACID INSENSITIVE 5 (GhABI5) is an important transcription factor in ABA signaling that can enhance Gladiolus corm dormancy and Arabidopsis seed dormancy.
    Front Plant Sci, 2015. 6: p. 960
    [PMID:26579187]
  176. Sun Y,Xu W,Jia Y,Wang M,Xia G
    The wheat TaGBF1 gene is involved in the blue-light response and salt tolerance.
    Plant J., 2015. 84(6): p. 1219-30
    [PMID:26588879]
  177. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  178. Dekkers BJ, et al.
    The Arabidopsis DELAY OF GERMINATION 1 gene affects ABSCISIC ACID INSENSITIVE 5 (ABI5) expression and genetically interacts with ABI3 during Arabidopsis seed development.
    Plant J., 2016. 85(4): p. 451-65
    [PMID:26729600]
  179. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  180. Huang Y,Feng CZ,Ye Q,Wu WH,Chen YF
    Arabidopsis WRKY6 Transcription Factor Acts as a Positive Regulator of Abscisic Acid Signaling during Seed Germination and Early Seedling Development.
    PLoS Genet., 2016. 12(2): p. e1005833
    [PMID:26829043]
  181. Yu Y, et al.
    Salt Stress and Ethylene Antagonistically Regulate Nucleocytoplasmic Partitioning of COP1 to Control Seed Germination.
    Plant Physiol., 2016. 170(4): p. 2340-50
    [PMID:26850275]
  182. Dave A,Vaistij FE,Gilday AD,Penfield SD,Graham IA
    Regulation of Arabidopsis thaliana seed dormancy and germination by 12-oxo-phytodienoic acid.
    J. Exp. Bot., 2016. 67(8): p. 2277-84
    [PMID:26873978]
  183. Mauri N, et al.
    GEM, a member of the GRAM domain family of proteins, is part of the ABA signaling pathway.
    Sci Rep, 2016. 6: p. 22660
    [PMID:26939893]
  184. Su M, et al.
    The LEA protein, ABR, is regulated by ABI5 and involved in dark-induced leaf senescence in Arabidopsis thaliana.
    Plant Sci., 2016. 247: p. 93-103
    [PMID:27095403]
  185. Yang X,Bai Y,Shang J,Xin R,Tang W
    The antagonistic regulation of abscisic acid-inhibited root growth by brassinosteroids is partially mediated via direct suppression of ABSCISIC ACID INSENSITIVE 5 expression by BRASSINAZOLE RESISTANT 1.
    Plant Cell Environ., 2016. 39(9): p. 1994-2003
    [PMID:27149247]
  186. Kim J, et al.
    PIF1-Interacting Transcription Factors and Their Binding Sequence Elements Determine the in Vivo Targeting Sites of PIF1.
    Plant Cell, 2016. 28(6): p. 1388-405
    [PMID:27303023]
  187. Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
    Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin.
    Plant Cell, 2016. 28(7): p. 1662-81
    [PMID:27317674]
  188. Carrió-Seguí À,Romero P,Sanz A,Peñarrubia L
    Interaction Between ABA Signaling and Copper Homeostasis in Arabidopsis thaliana.
    Plant Cell Physiol., 2016. 57(7): p. 1568-1582
    [PMID:27328696]
  189. Bai Y, et al.
    Genome-Wide Analysis of the bZIP Gene Family Identifies Two ABI5-Like bZIP Transcription Factors, BrABI5a and BrABI5b, as Positive Modulators of ABA Signalling in Chinese Cabbage.
    PLoS ONE, 2016. 11(7): p. e0158966
    [PMID:27414644]
  190. Yu D, et al.
    RPN1a negatively regulates ABA signaling in Arabidopsis.
    Plant Physiol. Biochem., 2016. 108: p. 279-285
    [PMID:27474935]
  191. Kazachkova Y, et al.
    Salt Induces Features of a Dormancy-Like State in Seeds of Eutrema (Thellungiella) salsugineum, a Halophytic Relative of Arabidopsis.
    Front Plant Sci, 2016. 7: p. 1071
    [PMID:27536302]
  192. Miao H, et al.
    Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation.
    Sci Rep, 2016. 6: p. 31854
    [PMID:27549907]
  193. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  194. Zhu Z, et al.
    Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance.
    Front Plant Sci, 2016. 7: p. 1285
    [PMID:27625663]
  195. Xie T, et al.
    Growing Slowly 1 locus encodes a PLS-type PPR protein required for RNA editing and plant development in Arabidopsis.
    J. Exp. Bot., 2016. 67(19): p. 5687-5698
    [PMID:27670716]
  196. Gu L, et al.
    An RRM-containing mei2-like MCT1 plays a negative role in the seed germination and seedling growth of Arabidopsis thaliana in the presence of ABA.
    Plant Physiol. Biochem., 2016. 109: p. 273-279
    [PMID:27771580]
  197. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]
  198. Lynch TJ,Erickson BJ,Miller DR,Finkelstein RR
    ABI5-binding proteins (AFPs) alter transcription of ABA-induced genes via a variety of interactions with chromatin modifiers.
    Plant Mol. Biol., 2017. 93(4-5): p. 403-418
    [PMID:27942958]
  199. Keren I,Citovsky V
    The histone deubiquitinase OTLD1 targets euchromatin to regulate plant growth.
    Sci Signal, 2016. 9(459): p. ra125
    [PMID:27999174]
  200. Xu J, et al.
    A Novel RNA-Binding Protein Involves ABA Signaling by Post-transcriptionally Repressing ABI2.
    Front Plant Sci, 2017. 8: p. 24
    [PMID:28174577]
  201. Bi C, et al.
    Arabidopsis ABI5 plays a role in regulating ROS homeostasis by activating CATALASE 1 transcription in seed germination.
    Plant Mol. Biol., 2017. 94(1-2): p. 197-213
    [PMID:28391398]
  202. Yu LH, et al.
    Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression.
    Mol Plant, 2017. 10(6): p. 834-845
    [PMID:28438576]
  203. Xiao X,Cheng X,Yin K,Li H,Qiu JL
    Abscisic acid negatively regulates post-penetration resistance of Arabidopsis to the biotrophic powdery mildew fungus.
    Sci China Life Sci, 2017. 60(8): p. 891-901
    [PMID:28702742]
  204. Bi C,Ma Y,Wang XF,Zhang DP
    Overexpression of the transcription factor NF-YC9 confers abscisic acid hypersensitivity in Arabidopsis.
    Plant Mol. Biol., 2017. 95(4-5): p. 425-439
    [PMID:28924726]
  205. Ueda M, et al.
    The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response.
    Plant Physiol., 2017. 175(4): p. 1760-1773
    [PMID:29018096]
  206. Ullah A,Sun H,Yang X,Zhang X
    A novel cotton WRKY gene, GhWRKY6-like, improves salt tolerance by activating the ABA signaling pathway and scavenging of reactive oxygen species.
    Physiol Plant, 2018. 162(4): p. 439-454
    [PMID:29027659]
  207. Huang Y, et al.
    Abscisic Acid Modulates Seed Germination via ABA INSENSITIVE5-Mediated PHOSPHATE1.
    Plant Physiol., 2017. 175(4): p. 1661-1668
    [PMID:29089393]
  208. Shi XP, et al.
    Overexpression of SDH confers tolerance to salt and osmotic stress, but decreases ABA sensitivity in Arabidopsis.
    Plant Biol (Stuttg), 2018. 20(2): p. 327-337
    [PMID:29125673]
  209. Zhu T, et al.
    The Asparagine-Rich Protein NRP Facilitates the Degradation of the PP6-type Phosphatase FyPP3 to Promote ABA Response in Arabidopsis.
    Mol Plant, 2018. 11(2): p. 257-268
    [PMID:29175650]
  210. Chang G, et al.
    AFP2 as the novel regulator breaks high-temperature-induced seeds secondary dormancy through ABI5 and SOM in Arabidopsis thaliana.
    Biochem. Biophys. Res. Commun., 2018. 501(1): p. 232-238
    [PMID:29723526]