PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G34720.1
Common NameNFYA4, NF-YA4, T29F13.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YA
Protein Properties Length: 198aa    MW: 22258.7 Da    PI: 9.2692
Description nuclear factor Y, subunit A4
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G34720.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.32e-3197153158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep++VNaKQy++Il+RRq+Rakle++++  +k++kpy+heSRh hA+rRpRg+gGrF
  AT2G34720.1  97 EEPVFVNAKQYHGILRRRQSRAKLEARNRA-IKAKKPYMHESRHLHAIRRPRGCGGRF 153
                  69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-3595156IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.98896156IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.4E-2698153IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.8E-2499121IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860101121IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.8E-24130153IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MTSSVHELSD NNESHAKKER PDSQTRPQVP SGRSSESIDT NSVYSEPMAH GLYPYPDPYY  60
RSVFAQQAYL PHPYPGVQLQ LMGMQQPGVP LQCDAVEEPV FVNAKQYHGI LRRRQSRAKL  120
EARNRAIKAK KPYMHESRHL HAIRRPRGCG GRFLNAKKEN GDHKEEEEAT SDENTSEASS  180
SLRSEKLAMA TSGPNGRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-2096166171NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.377690.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865053490.0
Genevisible267315_at0.0
Expression AtlasAT2G34720-
AtGenExpressAT2G34720-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, caulines, and senescent flowers. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G34720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G10800, AT3G48590, AT4G14540, AT5G50480, AT5G63470, AT1G08970, AT1G54830, AT1G56170
IntActSearch Q8VY64
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G34720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0724140.0AY072414.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds.
GenBankAY1147110.0AY114711.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850235.11e-146nuclear factor Y, subunit A4
SwissprotQ8VY641e-149NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBLD7LH391e-135D7LH39_ARALL; CCAAT-binding transcription factor (CBF-B/NF-YA) family protein
STRINGAT2G34720.11e-146(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Representative plantOGRP6801672
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Koroleva OA,Tomlinson ML,Leader D,Shaw P,Doonan JH
    High-throughput protein localization in Arabidopsis using Agrobacterium-mediated transient expression of GFP-ORF fusions.
    Plant J., 2005. 41(1): p. 162-74
    [PMID:15610358]
  6. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  7. Bi YM,Wang RL,Zhu T,Rothstein SJ
    Global transcription profiling reveals differential responses to chronic nitrogen stress and putative nitrogen regulatory components in Arabidopsis.
    BMC Genomics, 2007. 8: p. 281
    [PMID:17705847]
  8. Yamamoto A, et al.
    Arabidopsis NF-YB subunits LEC1 and LEC1-LIKE activate transcription by interacting with seed-specific ABRE-binding factors.
    Plant J., 2009. 58(5): p. 843-56
    [PMID:19207209]
  9. Liu JX,Howell SH
    bZIP28 and NF-Y transcription factors are activated by ER stress and assemble into a transcriptional complex to regulate stress response genes in Arabidopsis.
    Plant Cell, 2010. 22(3): p. 782-96
    [PMID:20207753]
  10. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  13. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  14. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]