PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G34440.1
Common NameAGL29
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 172aa    MW: 19753.3 Da    PI: 7.417
Description AGAMOUS-like 29
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G34440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.71.8e-191257449
                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 ++   rqvtfskRr+g++KKA+EL +LC+ae  +++fs+ gk + y
  AT2G34440.1 12 QDMNTRQVTFSKRRTGLFKKASELATLCNAELGIVVFSPGGKPFSY 57
                 56778**********************************9996665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.02161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-26171IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-32160IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-19323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0000423anatomyplant zygote
PO:0005660anatomyhydathode
PO:0009046anatomyflower
PO:0009089anatomyendosperm
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGRRKIKMEM VQDMNTRQVT FSKRRTGLFK KASELATLCN AELGIVVFSP GGKPFSYGKP  60
NLDSVAERFM REYDDSDSGD EEKSGNYRPK LKRLSERLDL LNQEVEAEKE RGEKSQEKLE  120
SAGDERFKES IETLTLDELN EYKDRLQTVH GRIEGQVNHL QASSCLMLLS RK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A8e-16169169MEF2 CHIMERA
6byy_B8e-16169169MEF2 CHIMERA
6byy_C8e-16169169MEF2 CHIMERA
6byy_D8e-16169169MEF2 CHIMERA
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266994_at0.0
Expression AtlasAT2G34440-
AtGenExpressAT2G34440-
ATTED-IIAT2G34440-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryogenesis, expressed in the chalazal endosperm. {ECO:0000269|PubMed:20631316}.
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G34440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G34440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0040770.0AC004077.3 Arabidopsis thaliana chromosome 2 clone T31E10 map ve016, complete sequence.
GenBankAC0044810.0AC004481.3 Arabidopsis thaliana chromosome 2 clone F13P17 map ve016, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180991.11e-123AGAMOUS-like 29
SwissprotO647031e-125AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLA0A178VU291e-122A0A178VU29_ARATH; AGL29
STRINGAT2G34440.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Becker JD,Boavida LC,Carneiro J,Haury M,Feij
    Transcriptional profiling of Arabidopsis tissues reveals the unique characteristics of the pollen transcriptome.
    Plant Physiol., 2003. 133(2): p. 713-25
    [PMID:14500793]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  8. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  9. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  10. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  11. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]