PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G34140.1
Common NameCDF4, DOF2.3, T14G11.26
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 170aa    MW: 18926.5 Da    PI: 9.5953
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G34140.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.34e-3954112260
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                  ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k 
  AT2G34140.1  54 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRKSKP 112
                  68999***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3053111IPR003851Zinc finger, Dof-type
PfamPF027014.6E-3256111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.12758112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009029anatomystamen
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MATQDSQGIK LFGKTIAFNT RTIKNEEETH PPEQEATIAV RSSSSSDLTA EKRPDKIIAC  60
PRCKSMETKF CYFNNYNVNQ PRHFCKGCHR YWTAGGALRN VPVGAGRRKS KPPGRVVVGM  120
LGDGNGVRQV ELINGLLVEE WQHAAAAAHG SFRHDFPMKR LRCYSDGQSC
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256720_at0.0
Expression AtlasAT2G34140-
AtGenExpressAT2G34140-
ATTED-IIAT2G34140-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G34140.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G34140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0023410.0AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence.
GenBankAK2213080.0AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19.
GenBankBT0104960.0BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180961.11e-127Dof-type zinc finger DNA-binding family protein
SwissprotO229671e-128CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A178VWS91e-125A0A178VWS9_ARATH; Uncharacterized protein
STRINGAT2G34140.11e-127(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Rogers LA, et al.
    Comparison of lignin deposition in three ectopic lignification mutants.
    New Phytol., 2005. 168(1): p. 123-40
    [PMID:16159327]
  7. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  8. Fornara F, et al.
    Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.
    Dev. Cell, 2009. 17(1): p. 75-86
    [PMID:19619493]
  9. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  10. Pi L, et al.
    Organizer-Derived WOX5 Signal Maintains Root Columella Stem Cells through Chromatin-Mediated Repression of CDF4 Expression.
    Dev. Cell, 2015. 33(5): p. 576-88
    [PMID:26028217]
  11. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]