PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G33500.1
Common NameBBX12, COL14, F4P9.27
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 402aa    MW: 44519.7 Da    PI: 7.2379
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G33500.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.31e-051149537
     zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                  C+ ++e  + lfC+ +   lC  C ++ H+       H
  AT2G33500.1 11 ACEFCGERTAVLFCRADTAKLCLPCDQHVHSAnllsrkH 49
                 7******99*******************99555665556 PP

2zf-B_box22.72.1e-075294339
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                  ++C+++++++++  C++++  lC++C    H +      H++
  AT2G33500.1 52 SQICDNCSKEPVSVRCFTDNLVLCQECDWDVHGScsssatHER 94
                 689************************9988844667777765 PP

3CCT652.1e-22357400144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a++RYkeK+ktR+++K+irYe+RKa+Ae+R RvKGrFvk++
  AT2G33500.1 357 RDNAMQRYKEKKKTRRYDKTIRYETRKARAETRLRVKGRFVKAT 400
                  899***************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-13754IPR000315B-box-type zinc finger
PROSITE profilePS501199.769754IPR000315B-box-type zinc finger
CDDcd000211.62E-81042No hitNo description
PROSITE profilePS501199.2295097IPR000315B-box-type zinc finger
CDDcd000215.27E-75483No hitNo description
SMARTSM003361.15597IPR000315B-box-type zinc finger
PfamPF062031.1E-16357399IPR010402CCT domain
PROSITE profilePS5101714.852357399IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MGTSTTESVV ACEFCGERTA VLFCRADTAK LCLPCDQHVH SANLLSRKHV RSQICDNCSK  60
EPVSVRCFTD NLVLCQECDW DVHGSCSSSA THERSAVEGF SGCPSVLELA AVWGIDLKGK  120
KKEDDEDELT KNFGMGLDSW GSGSNIVQEL IVPYDVSCKK QSFSFGRSKQ VVFEQLELLK  180
RGFVEGEGEI MVPEGINGGG SISQPSPTTS FTSLLMSQSL CGNGMQWNAT NHSTGQNTQI  240
WDFNLGQSRN PDEPSPVETK GSTFTFNNVT HLKNDTRTTN MNAFKESYQQ EDSVHSTSTK  300
GQETSKSNNI PAAIHSHKSS NDSCGLHCTE HIAITSNRAT RLVAVTNADL EQMAQNRDNA  360
MQRYKEKKKT RRYDKTIRYE TRKARAETRL RVKGRFVKAT DP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.434930.0floral meristem| flower| inflorescence| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306857300.0
Genevisible255839_at1e-155
Expression AtlasAT2G33500-
AtGenExpressAT2G33500-
ATTED-IIAT2G33500-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G33500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch O22800
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G33500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0020670.0BT002067.1 Arabidopsis thaliana putative CONSTANS-like B-box zinc finger protein (At2g33500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850211.10.0zinc finger protein CONSTANS-LIKE 14
SwissprotO228000.0COL14_ARATH; Zinc finger protein CONSTANS-LIKE 14
TrEMBLC0SV720.0C0SV72_ARATH; Putative uncharacterized protein At2g33500 (Fragment)
STRINGAT2G33500.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5453813
MalvidsOGEM38712647
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  6. Karlova R, et al.
    The Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE1 protein complex includes BRASSINOSTEROID-INSENSITIVE1.
    Plant Cell, 2006. 18(3): p. 626-38
    [PMID:16473966]
  7. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]