PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G33480.1
Common NameANAC041, NAC041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 268aa    MW: 31124.3 Da    PI: 9.5098
Description NAC domain containing protein 41
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G33480.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.95.9e-51151371128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+d++k++PwdLp      e+e+yfFs+r+ ky++g+r+nr+t sgyWkatg dk++ + k+ 
  AT2G33480.1  15 LPPGFRFHPTDEELVVQYLRRKVTGLPLPA-SVIPETDVCKSDPWDLPGD---CESEMYFFSTREAKYPNGNRSNRSTGSGYWKATGLDKQIGK-KKL 107
                  79****************************.99***************44...4679***********************************99.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kktLvfykg+ p+g++t+Wv+heyrl
  AT2G33480.1 108 VVGMKKTLVFYKGKPPNGTRTNWVLHEYRL 137
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6110160IPR003441NAC domain
PROSITE profilePS5100556.68615160IPR003441NAC domain
PfamPF023652.8E-2716137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEKRSSIKNR GVLRLPPGFR FHPTDEELVV QYLRRKVTGL PLPASVIPET DVCKSDPWDL  60
PGDCESEMYF FSTREAKYPN GNRSNRSTGS GYWKATGLDK QIGKKKLVVG MKKTLVFYKG  120
KPPNGTRTNW VLHEYRLVDS QQDSLYGQNM NWVLCRVFLK KRSNSNSKRK EDEKEEVENE  180
KETETERERE EENKKSTCPI FYDFMRKDTK KKRRRRRCCD LNLTPATCCC CSSSTSSSSV  240
CSSALTHTSS NDNRQEISYR ENKFCLFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-541316315168NO APICAL MERISTEM PROTEIN
1ut4_B4e-541316315168NO APICAL MERISTEM PROTEIN
1ut7_A4e-541316315168NO APICAL MERISTEM PROTEIN
1ut7_B4e-541316315168NO APICAL MERISTEM PROTEIN
3swm_A4e-541316318171NAC domain-containing protein 19
3swm_B4e-541316318171NAC domain-containing protein 19
3swm_C4e-541316318171NAC domain-containing protein 19
3swm_D4e-541316318171NAC domain-containing protein 19
3swp_A4e-541316318171NAC domain-containing protein 19
3swp_B4e-541316318171NAC domain-containing protein 19
3swp_C4e-541316318171NAC domain-containing protein 19
3swp_D4e-541316318171NAC domain-containing protein 19
4dul_A4e-541316315168NAC domain-containing protein 19
4dul_B4e-541316315168NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209214KKKRRR
2210216KKRRRRR
3211216KRRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.475200.0leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453605770.0
Genevisible255794_at0.0
Expression AtlasAT2G33480-
AtGenExpressAT2G33480-
ATTED-IIAT2G33480-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of the mannan synthase CSLA9. Recognizes and binds to DNA-specific sequence of CSLA9 promoter. {ECO:0000269|PubMed:24243147}.
Function -- GeneRIF ? help Back to Top
  1. Data indicate that transcription factors ANAC041, bZIP1 and MYB46 directly regulate the expression of CSLA9.
    [PMID: 24243147]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G33480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G02150, AT5G13180
IntActSearch O22798
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:24243147}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G33480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0937300.0AY093730.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds.
GenBankAF4102990.0AF410299.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds.
GenBankAF3250800.0AF325080.1 Arabidopsis thaliana putative NAM (no apical meristem)-like protein (At2g33480) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180906.10.0NAC domain containing protein 41
SwissprotO227980.0NAC41_ARATH; NAC domain-containing protein 41
TrEMBLB3H6361e-148B3H636_ARATH; NAC domain containing protein 41
STRINGAT2G33480.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM18062786
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hammond JP, et al.
    Changes in gene expression in Arabidopsis shoots during phosphate starvation and the potential for developing smart plants.
    Plant Physiol., 2003. 132(2): p. 578-96
    [PMID:12805589]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  6. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  7. Price AM, et al.
    A comparison of leaf and petal senescence in wallflower reveals common and distinct patterns of gene expression and physiology.
    Plant Physiol., 2008. 147(4): p. 1898-912
    [PMID:18539778]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Kim WC, et al.
    Transcription factors that directly regulate the expression of CSLA9 encoding mannan synthase in Arabidopsis thaliana.
    Plant Mol. Biol., 2014. 84(4-5): p. 577-87
    [PMID:24243147]