PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G32250.1
Common NameFRS2, T32F6.23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 807aa    MW: 91968 Da    PI: 6.5447
Description FAR1-related sequence 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G32250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR176.74.7e-2453138291
         FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                  fY+eYA++vGF +++++s++skr+g++++ +  Cs+ g+++e+ ++     ++r+  +tgCka l++k+++d+kw+++++++eHnHe++p
  AT2G32250.1  53 FYREYARSVGFGITIKASRRSKRSGKFIDVKIACSRFGTKREKATA----INPRSCPKTGCKAGLHMKRKEDEKWVIYNFVKEHNHEICP 138
                  9***************************************998877....99***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-2153138IPR004330FAR1 DNA binding domain
PfamPF105511.5E-22219311IPR018289MULE transposase domain
PfamPF044346.5E-8499534IPR007527Zinc finger, SWIM-type
PROSITE profilePS5096610.274499535IPR007527Zinc finger, SWIM-type
SMARTSM005751.3E-7510537IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MDDEDVEIDL LTKSSNVDVF CEASTSGNVA QCATVSELRN GMDFESKEAA YYFYREYARS  60
VGFGITIKAS RRSKRSGKFI DVKIACSRFG TKREKATAIN PRSCPKTGCK AGLHMKRKED  120
EKWVIYNFVK EHNHEICPDD FYVSVRGKNK PAGALAIKKG LQLALEEEDL KLLLEHFMEM  180
QDKQPGFFYA VDFDSDKRVR NVFWLDAKAK HDYCSFSDVV LFDTFYVRNG YRIPFAPFIG  240
VSHHRQYVLL GCALIGEVSE STYSWLFRTW LKAVGGQAPG VMITDQDKLL SDIVVEVFPD  300
VRHIFCLWSV LSKISEMLNP FVSQDDGFME SFGNCVASSW TDEHFERRWS NMIGKFELNE  360
NEWVQLLFRD RKKWVPHYFH GICLAGLSGP ERSGSIASHF DKYMNSEATF KDFFELYMKF  420
LQYRCDVEAK DDLEYQSKQP TLRSSLAFEK QLSLIYTDAA FKKFQAEVPG VVSCQLQKER  480
EDGTTAIFRI EDFEERQNFF VALNNELLDA CCSCHLFEYQ GFLCKHAILV LQSADVSRVP  540
SQYILKRWSK KGNNKEDKND KCATIDNRMA RFDDLCRRFV KLGVVASLSD EACKTALKLL  600
EETVKHCVSM DNSSKFPSEP DKLMTGGSIG LENEGVLDCA SKVSKKKKIQ KKRKVYCGPE  660
DATNRSEELR QETEQVSSRA PTFENCYIPQ ANMEEPELGS RATTLGVYYS TQQTNQGFPS  720
ISSIQNGYYG HPPTIQAMGN LHSIHERMSQ YETQPSMQGA FQGQTGFRGS AIRGCYDIEE  780
TLHDMTMGSS QFQGSDSSHP SDHRLSN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.131890.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266360_at0.0
Expression AtlasAT2G32250-
AtGenExpressAT2G32250-
ATTED-IIAT2G32250-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G32250.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G32250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2287300.0AK228730.1 Arabidopsis thaliana mRNA for Mutator-like transposase, complete cds, clone: RAFL16-06-P03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077991.10.0FAR1-related protein
RefseqNP_180784.20.0FAR1-related protein
SwissprotQ3EBQ30.0FRS2_ARATH; Protein FAR1-RELATED SEQUENCE 2
TrEMBLR0HA260.0R0HA26_9BRAS; Uncharacterized protein
STRINGAT2G32250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MalvidsOGEM11826253
Publications ? help Back to Top
  1. Lin R,Wang H
    Arabidopsis FHY3/FAR1 gene family and distinct roles of its members in light control of Arabidopsis development.
    Plant Physiol., 2004. 136(4): p. 4010-22
    [PMID:15591448]
  2. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  3. Jones AM, et al.
    Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana.
    J Proteomics, 2009. 72(3): p. 439-51
    [PMID:19245862]