PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G31370.6
Common NameBZIP59, POSF21, T28P16.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 398aa    MW: 44689.5 Da    PI: 6.5195
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G31370.6genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.5e-10203261563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+     l+ e+
  AT2G31370.6 203 KRAKRIWANRQSAARSKERKTRYIFELERKVQTLQTEATTLSAQLTLLQRDTNGLTVEN 261
                  9********************************************99998887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-15199263IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565201264IPR004827Basic-leucine zipper domain
PfamPF001707.0E-9203255IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-10203254No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-11203257No hitNo description
CDDcd147037.26E-22204253No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDKEKSPAPP CGGLPPPSPS GRCSAFSEAG PIGHGSDANR MSHDISRMLD NPPKKIGHRR  60
AHSEILTLPD DLSFDSDLGV VGNAADGASF SDETEEDLLS MYLDMDKFNS SATSSAQVGE  120
PSGTAWKNET MMQTGTGSTS NPQNTVNSLG ERPRIRHQHS QSMDGSMNIN EMLMSGNEDD  180
SAIDAKKSMS ATKLAELALI DPKRAKRIWA NRQSAARSKE RKTRYIFELE RKVQTLQTEA  240
TTLSAQLTLL QRDTNGLTVE NNELKLRLQT MEQQVHLQDE LNEALKEEIQ HLKVLTGQVA  300
PSALNYGSFG SNQQQFYSNN QSMQTILAAK QFQQLQIHSQ KQQQQQQQQQ QQHQQQQQQQ  360
QQYQFQQQQM QQLMQQRLQQ QEQQNGVRLK PSQAQKEN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.990.0bud| flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263253_at0.0
Expression AtlasAT2G31370-
AtGenExpressAT2G31370-
ATTED-IIAT2G31370-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Function -- GeneRIF ? help Back to Top
  1. AIR1 is involved in the regulation of various steps of the flavonoid and anthocyanin accumulation pathways and is itself regulated by the salt-stress response signalling machinery.
    [PMID: 23925404]
  2. These findings define the AtbZIP59-LBD complex as a critical regulator of auxin-induced cell fate change during callus formation, which provides a new insight into the molecular regulation of plant regeneration and possible developmental programs.
    [PMID: 29358751]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G31370.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G43700
IntActSearch Q04088
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G31370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3170870.0AK317087.1 Arabidopsis thaliana AT2G31370 mRNA, complete cds, clone: RAFL21-87-G20.
GenBankAY0575340.0AY057534.1 Arabidopsis thaliana At2g31370/T28P16.14 mRNA, complete cds.
GenBankAY1130580.0AY113058.1 Arabidopsis thaliana At2g31370/T28P16.14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031456.20.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_001189650.10.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_001318327.10.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_180695.10.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_850167.10.0Basic-leucine zipper (bZIP) transcription factor family protein
RefseqNP_850168.20.0Basic-leucine zipper (bZIP) transcription factor family protein
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A384L5030.0A0A384L503_ARATH; Uncharacterized protein
TrEMBLB9DGB10.0B9DGB1_ARATH; AT2G31370 protein
STRINGAT2G31370.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  5. Kang JG,Pyo YJ,Cho JW,Cho MH
    Comparative proteome analysis of differentially expressed proteins induced by K+ deficiency in Arabidopsis thaliana.
    Proteomics, 2004. 4(11): p. 3549-59
    [PMID:15449379]
  6. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  7. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  8. Zhu Y, et al.
    Arabidopsis NRP1 and NRP2 encode histone chaperones and are required for maintaining postembryonic root growth.
    Plant Cell, 2006. 18(11): p. 2879-92
    [PMID:17122067]
  9. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  10. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  11. Aeschbacher RA,Schrott M,Potrykus I,Saul MW
    Isolation and molecular characterization of PosF21, an Arabidopsis thaliana gene which shows characteristics of a b-Zip class transcription factor.
    Plant J., 1991. 1(3): p. 303-16
    [PMID:1844885]
  12. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  13. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  14. Van Oosten MJ,Sharkhuu A,Batelli G,Bressan RA,Maggio A
    The Arabidopsis thaliana mutant air1 implicates SOS3 in the regulation of anthocyanins under salt stress.
    Plant Mol. Biol., 2013. 83(4-5): p. 405-15
    [PMID:23925404]
  15. Tsugama D,Liu S,Takano T
    Analysis of functions of VIP1 and its close homologs in osmosensory responses of Arabidopsis thaliana.
    PLoS ONE, 2014. 9(8): p. e103930
    [PMID:25093810]
  16. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]